Human BAX/Bax zeta ORF/cDNA clone-Adenovirus plasmid (BC014175)

Cat. No.: pGMAP-SPh-155
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human BAX/Bax zeta adenoviral expression plasmid for BAX adenovirus packaging, BAX adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to BAX/Bax zeta products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-SPh-155
Gene Name BAX
Accession Number BC014175
Gene ID 581
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 579 bp
Gene Alias Bax zeta
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGACGGGTCCGGGGAGCAGCCCAGAGGCGGGGGGCCCACCAGCTCTGAGCAGATCATGAAGACAGGGGCCCTTTTGCTTCAGGGTTTCATCCAGGATCGAGCAGGGCGAATGGGGGGGGAGGCACCCGAGCTGGCCCTGGACCCGGTGCCTCAGGATGCGTCCACCAAGAAGCTGAGCGAGTGTCTCAAGCGCATCGGGGACGAACTGGACAGTAACATGGAGCTGCAGAGGATGATTGCCGCCGTGGACACAGACTCCCCCCGAGAGGTCTTTTTCCGAGTGGCAGCTGACATGTTTTCTGACGGCAACTTCAACTGGGGCCGGGTTGTCGCCCTTTTCTACTTTGCCAGCAAACTGGTGCTCAAGGCCCTGTGCACCAAGGTGCCGGAACTGATCAGAACCATCATGGGCTGGACATTGGACTTCCTCCGGGAGCGGCTGTTGGGCTGGATCCAAGACCAGGGTGGTTGGGACGGCCTCCTCTCCTACTTTGGGACGCCCACGTGGCAGACCGTGACCATCTTTGTGGCGGGAGTGCTCACCGCCTCACTCACCATCTGGAAGAAGATGGGCTGA
ORF Protein Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0034-Ab Anti-BAX monoclonal antibody
    Target Antigen GM-Tg-g-IP0034-Ag BAX protein
    ORF Viral Vector pGMAD000113 Human BAX Adenovirus plasmid
    ORF Viral Vector pGMAP000055 Human BAX Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-015 Human BAX Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-155 Human BAX Adenovirus plasmid
    ORF Viral Vector vGMAD000113 Human BAX Adenovirus particle
    ORF Viral Vector vGMAP000055 Human BAX Adenovirus particle
    ORF Viral Vector vGMLP-SPh-015 Human BAX Lentivirus particle
    ORF Viral Vector vGMAP-SPh-155 Human BAX Adenovirus particle


    Target information

    Target ID GM-IP0034
    Target Name BAX
    Gene Group Identifier
    (Target Gene ID in Homo species)
    581
    Gene ID 100054674 (Equus caballus), 12028 (Mus musculus), 24887 (Rattus norvegicus), 280730 (Bos taurus)
    403523 (Canis lupus familiaris), 493837 (Felis catus), 581 (Homo sapiens), 718948 (Macaca mulatta)
    Gene Symbols & Synonyms BAX,Bax,BCL2L4
    Target Alternative Names Apoptosis regulator BAX,BAX,BCL2L4,Bax,Bcl-2-like protein 4 (Bcl2-L-4)
    Uniprot Accession O02703,Q07812,Q07813,Q63690
    Additional SwissProt Accessions: Q07813,Q63690,O02703,Q07812
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, Sphingolipid signaling pathway, p53 signaling pathway, Protein processing in endoplasmic reticulum, Apoptosis, Longevity regulating pathway, Apoptosis - multiple species, Neurotrophin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Pathogenic Escherichia coli infection, Tuberculosis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000016635, ENSMUSG00000003873, ENSBTAG00000013340, ENSCAFG00845000500, ENSG00000087088, ENSMMUG00000003907
    Target Classification Pathway, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.