Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IL37/FIL1/FIL1(ZETA) ORF/cDNA clone-Adenovirus plasmid (NM_014439)
Cat. No.: pGMAP-IL-126
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL37/FIL1/FIL1(ZETA) adenoviral expression plasmid for IL37 adenovirus packaging, IL37 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Datasheet
Go to
IL-1F7/IL-37/IL37/IL37/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP-IL-126 |
| Gene Name | IL37 |
| Accession Number | NM_014439 |
| Gene ID | 27178 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 657 bp |
| Gene Alias | FIL1,FIL1(ZETA),FIL1Z,IL-1F7,IL-1H,IL-1H4,IL-1RP1,IL-37,IL1F7,IL1H4,IL1RP1 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGTCCTTTGTGGGGGAGAACTCAGGAGTGAAAATGGGCTCTGAGGACTGGGAAAAAGATGAACCCCAGTGCTGCTTAGAAGACCCGGCTGGAAGCCCCCTGGAACCAGGCCCAAGCCTCCCCACCATGAATTTTGTTCACACAAGTCCAAAGGTGAAGAACTTAAACCCGAAGAAATTCAGCATTCATGACCAGGATCACAAAGTACTGGTCCTGGACTCTGGGAATCTCATAGCAGTTCCAGATAAAAACTACATACGCCCAGAGATCTTCTTTGCATTAGCCTCATCCTTGAGCTCAGCCTCTGCGGAGAAAGGAAGTCCGATTCTCCTGGGGGTCTCTAAAGGGGAGTTTTGTCTCTACTGTGACAAGGATAAAGGACAAAGTCATCCATCCCTTCAGCTGAAGAAGGAGAAACTGATGAAGCTGGCTGCCCAAAAGGAATCAGCACGCCGGCCCTTCATCTTTTATAGGGCTCAGGTGGGCTCCTGGAACATGCTGGAGTCGGCGGCTCACCCCGGATGGTTCATCTGCACCTCCTGCAATTGTAATGAGCCTGTTGGGGTGACAGATAAATTTGAGAACAGGAAACACATTGAATTTTCATTTCAACCAGTTTGCAAAGCTGAAATGAGCCCCAGTGAGGTCAGCGATTAG |
| ORF Protein Sequence | MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T96845-Ab | Anti-IL37/ FIL1/ FIL1(ZETA) functional antibody |
| Target Antigen | GM-Tg-g-T96845-Ag | IL37 protein |
| Cytokine | cks-Tg-g-GM-T96845 | interleukin 37 (IL37) protein & antibody |
| ORF Viral Vector | pGMLV000120 | Human IL37 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000475 | Human IL37 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000269 | Human IL1F7 Adenovirus plasmid |
| ORF Viral Vector | pGMLP-IL-043 | Human IL37 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-126 | Human IL37 Adenovirus plasmid |
| ORF Viral Vector | vGMLV000120 | Human IL37 Lentivirus particle |
| ORF Viral Vector | vGMAAV000475 | Human IL37 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000269 | Human IL1F7 Adenovirus particle |
| ORF Viral Vector | vGMLP-IL-043 | Human IL37 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-126 | Human IL37 Adenovirus particle |
Target information
| Target ID | GM-T96845 |
| Target Name | IL-1F7/IL-37/IL37 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
27178 |
| Gene ID |
100052470 (Equus caballus), 100686057 (Canis lupus familiaris), 27178 (Homo sapiens), 700579 (Macaca mulatta) 786493 (Bos taurus) |
| Gene Symbols & Synonyms | IL37,FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA) |
| Target Alternative Names | IL-1F7, IL-37, IL37,Interleukin-37,IL-37,FIL1 zeta, IL-1X, Interleukin-1 family member 7 (IL-1F7), Interleukin-1 homolog 4 (IL-1H, IL-1H4), Interleukin-1 zeta (IL-1 zeta), Interleukin-1-related protein (IL-1RP1),FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA) |
| Uniprot Accession |
Q9NZH6
Additional SwissProt Accessions: Q9NZH6 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor |
| Gene Ensembl | ENSECAG00000015732, ENSCAFG00845011516, ENSG00000125571, ENSMMUG00000005922, ENSBTAG00000013675 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.