Human IL21/CVID11/IL-21 ORF/cDNA clone-Adenovirus plasmid (NM_021803)

Cat. No.: pGMAP-IL-111
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL21/CVID11/IL-21 adenoviral expression plasmid for IL21 adenovirus packaging, IL21 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-21/IL21/IL21/CVID11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-111
Gene Name IL21
Accession Number NM_021803
Gene ID 59067
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 489 bp
Gene Alias CVID11,IL-21,Za11
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAGATCCAGTCCTGGCAACATGGAGAGGATTGTCATCTGTCTGATGGTCATCTTCTTGGGGACACTGGTCCACAAATCAAGCTCCCAAGGTCAAGATCGCCACATGATTAGAATGCGTCAACTTATAGATATTGTTGATCAGCTGAAAAATTATGTGAATGACTTGGTCCCTGAATTTCTGCCAGCTCCAGAAGATGTAGAGACAAACTGTGAGTGGTCAGCTTTTTCCTGCTTTCAGAAGGCCCAACTAAAGTCAGCAAATACAGGAAACAATGAAAGGATAATCAATGTATCAATTAAAAAGCTGAAGAGGAAACCACCTTCCACAAATGCAGGGAGAAGACAGAAACACAGACTAACATGCCCTTCATGTGATTCTTATGAGAAAAAACCACCCAAAGAATTCCTAGAAAGATTCAAATCACTTCTCCAAAAGATGATTCATCAGCATCTGTCCTCTAGAACACACGGAAGTGAAGATTCCTGA
ORF Protein Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-041 Pre-Made Avizakimab biosimilar, Whole mAb, Anti-IL21 Antibody: Anti-CVID11/IL-21/Za11 therapeutic antibody
    Target Antibody GM-Tg-g-T51223-Ab Anti-IL21/ CVID11/ IL-21 functional antibody
    Target Antigen GM-Tg-g-T51223-Ag IL21 protein
    ORF Viral Vector pGMLP002995 Human IL21 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-028 Human IL21 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-111 Human IL21 Adenovirus plasmid
    ORF Viral Vector pGMPC001659 Human IL21 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004772 Human IL21 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002995 Human IL21 Lentivirus particle
    ORF Viral Vector vGMLP-IL-028 Human IL21 Lentivirus particle
    ORF Viral Vector vGMAP-IL-111 Human IL21 Adenovirus particle


    Target information

    Target ID GM-T51223
    Target Name IL-21/IL21
    Gene Group Identifier
    （Target Gene ID in Homo species)         		59067
    Gene ID 100063803 (Equus caballus), 101087399 (Felis catus), 365769 (Rattus norvegicus), 378475 (Bos taurus)
    442935 (Canis lupus familiaris), 59067 (Homo sapiens), 60505 (Mus musculus), 708125 (Macaca mulatta)
    Gene Symbols & Synonyms IL21,Il21,IL-21,Za11,CVID11
    Target Alternative Names CVID11,IL-21,IL21,Il21,Interleukin-21,Za11
    Uniprot Accession A3QPB9,Q6L7I9,Q76LU5,Q9ES17,Q9HBE4
    Additional SwissProt Accessions: A3QPB9,Q76LU5,Q6L7I9,Q9HBE4,Q9ES17
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Th17 cell differentiation, Inflammatory bowel disease
    Gene Ensembl ENSECAG00000037491, ENSBTAG00000012368, ENSCAFG00845020106, ENSG00000138684, ENSMUSG00000027718, ENSMMUG00000049383
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.