Human IL17C/CX2/IL-17C ORF/cDNA clone-Adenovirus plasmid (NM_013278)

Cat. No.: pGMAP-IL-105
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL17C/CX2/IL-17C adenoviral expression plasmid for IL17C adenovirus packaging, IL17C adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to IL17C/CX2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-105
Gene Name IL17C
Accession Number NM_013278
Gene ID 27189
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 594 bp
Gene Alias CX2,IL-17C
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGACGCTCCTCCCCGGCCTCCTGTTTCTGACCTGGCTGCACACATGCCTGGCCCACCATGACCCCTCCCTCAGGGGGCACCCCCACAGTCACGGTACCCCACACTGCTACTCGGCTGAGGAACTGCCCCTCGGCCAGGCCCCCCCACACCTGCTGGCTCGAGGTGCCAAGTGGGGGCAGGCTTTGCCTGTAGCCCTGGTGTCCAGCCTGGAGGCAGCAAGCCACAGGGGGAGGCACGAGAGGCCCTCAGCTACGACCCAGTGCCCGGTGCTGCGGCCGGAGGAGGTGTTGGAGGCAGACACCCACCAGCGCTCCATCTCACCCTGGAGATACCGTGTGGACACGGATGAGGACCGCTATCCACAGAAGCTGGCCTTCGCCGAGTGCCTGTGCAGAGGCTGTATCGATGCACGGACGGGCCGCGAGACAGCTGCGCTCAACTCCGTGCGGCTGCTCCAGAGCCTGCTGGTGCTGCGCCGCCGGCCCTGCTCCCGCGACGGCTCGGGGCTCCCCACACCTGGGGCCTTTGCCTTCCACACCGAGTTCATCCACGTCCCCGTCGGCTGCACCTGCGTGCTGCCCCGTTCAGTGTGA
ORF Protein Sequence MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1022-Ab Anti-IL17C/ CX2/ IL-17C functional antibody
    Target Antigen GM-Tg-g-SE1022-Ag IL17C protein
    Cytokine cks-Tg-g-GM-SE1022 interleukin 17C (IL17C) protein & antibody
    ORF Viral Vector pGMLP004492 Human IL17C Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-022 Human IL17C Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-105 Human IL17C Adenovirus plasmid
    ORF Viral Vector vGMLP004492 Human IL17C Lentivirus particle
    ORF Viral Vector vGMLP-IL-022 Human IL17C Lentivirus particle
    ORF Viral Vector vGMAP-IL-105 Human IL17C Adenovirus particle


    Target information

    Target ID GM-SE1022
    Target Name IL17C
    Gene Group Identifier
    (Target Gene ID in Homo species)
    27189
    Gene ID 100050766 (Equus caballus), 101097443 (Felis catus), 234836 (Mus musculus), 27189 (Homo sapiens)
    608988 (Canis lupus familiaris), 691516 (Rattus norvegicus), 710618 (Macaca mulatta)
    Gene Symbols & Synonyms IL17C,Il17c,IL-17C,CX2
    Target Alternative Names CX2,Cytokine CX2,IL-17C,IL17C,Il17c,Interleukin-17C
    Uniprot Accession Q8K4C5,Q9P0M4
    Additional SwissProt Accessions: Q8K4C5,Q9P0M4
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, IL-17 signaling pathway
    Gene Ensembl ENSMUSG00000046108, ENSG00000124391, ENSMMUG00000014324
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.