Human IL12A/CLMF/IL-12A ORF/cDNA clone-Adenovirus plasmid (NM_000882)
Cat. No.: pGMAP-IL-098
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL12A/CLMF/IL-12A adenoviral expression plasmid for IL12A adenovirus packaging, IL12A adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL-12/IL12A/IL12A/CLMF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP-IL-098 |
| Gene Name | IL12A |
| Accession Number | NM_000882 |
| Gene ID | 3592 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 762 bp |
| Gene Alias | CLMF,IL-12A,NFSK,NKSF1,P35 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGTGGCCCCCTGGGTCAGCCTCCCAGCCACCGCCCTCACCTGCCGCGGCCACAGGTCTGCATCCAGCGGCTCGCCCTGTGTCCCTGCAGTGCCGGCTCAGCATGTGTCCAGCGCGCAGCCTCCTCCTTGTGGCTACCCTGGTCCTCCTGGACCACCTCAGTTTGGCCAGAAACCTCCCCGTGGCCACTCCAGACCCAGGAATGTTCCCATGCCTTCACCACTCCCAAAACCTGCTGAGGGCCGTCAGCAACATGCTCCAGAAGGCCAGACAAACTCTAGAATTTTACCCTTGCACTTCTGAAGAGATTGATCATGAAGATATCACAAAAGATAAAACCAGCACAGTGGAGGCCTGTTTACCATTGGAATTAACCAAGAATGAGAGTTGCCTAAATTCCAGAGAGACCTCTTTCATAACTAATGGGAGTTGCCTGGCCTCCAGAAAGACCTCTTTTATGATGGCCCTGTGCCTTAGTAGTATTTATGAAGACTTGAAGATGTACCAGGTGGAGTTCAAGACCATGAATGCAAAGCTTCTGATGGATCCTAAGAGGCAGATCTTTCTAGATCAAAACATGCTGGCAGTTATTGATGAGCTGATGCAGGCCCTGAATTTCAACAGTGAGACTGTGCCACAAAAATCCTCCCTTGAAGAACCGGATTTTTATAAAACTAAAATCAAGCTCTGCATACTTCTTCATGCTTTCAGAATTCGGGCAGTGACTATTGATAGAGTGATGAGCTATCTGAATGCTTCCTAA |
| ORF Protein Sequence | MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T13251-Ab | Anti-IL12A/ CLMF/ IL-12A functional antibody |
| Target Antigen | GM-Tg-g-T13251-Ag | IL12A protein |
| Cytokine | cks-Tg-g-GM-T13251 | IL-12 p70 (IL12A) protein & antibody |
| ORF Viral Vector | pGMLV000443 | Human IL12A Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-015 | Human IL12A Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-098 | Human IL12A Adenovirus plasmid |
| ORF Viral Vector | vGMLV000443 | Human IL12A Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-015 | Human IL12A Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-098 | Human IL12A Adenovirus particle |
Target information
| Target ID | GM-T13251 |
| Target Name | IL-12/IL12A |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3592 |
| Gene ID |
100034215 (Equus caballus), 16159 (Mus musculus), 281856 (Bos taurus), 3592 (Homo sapiens) 403977 (Canis lupus familiaris), 493741 (Felis catus), 703205 (Macaca mulatta), 84405 (Rattus norvegicus) |
| Gene Symbols & Synonyms | IL12A,Il12a,IL-12A,p35,Ll12a,Il-12a,IL-12p35,IL12p35,Il-12 p35,P35,CLMF,NFSK,NKSF1,CLMF p35 |
| Target Alternative Names | CLMF,CLMF p35,Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35),IL-12,IL-12 subunit p35,IL-12A,IL-12p35,IL12A,IL12p35,Il-12 p35,Il-12a,Il12a,Interleukin-12 subunit alpha,Ll12a,NFSK,NK cell stimulatory factor chain 1 (NKSF1),NKSF1,P35,p35 |
| Uniprot Accession |
O02743,P29459,P43431,P48091,P54349,Q28267,Q9R103,Q9XSQ6
Additional SwissProt Accessions: Q9XSQ6,P43431,P54349,P29459,Q28267,O02743,P48091,Q9R103 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer, malignant glioma |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, Th1 and Th2 cell differentiation, Alcoholic liver disease, Type I diabetes mellitus, Pertussis, Legionellosis, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Measles, Influenza A, Pathways in cancer, Inflammatory bowel disease, Allograft rejection, Lipid and atherosclerosis |
| Gene Ensembl | ENSECAG00000024671, ENSMUSG00000027776, ENSBTAG00000015150, ENSG00000168811, ENSCAFG00845026803, ENSMMUG00000023084 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


