Human IL11/AGIF/IL-11 ORF/cDNA clone-Adenovirus plasmid (NM_000641)

Cat. No.: pGMAP-IL-097
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL11/AGIF/IL-11 adenoviral expression plasmid for IL11 adenovirus packaging, IL11 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-11/IL11/IL11/AGIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-IL-097
Gene Name IL11
Accession Number NM_000641
Gene ID 3589
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 600 bp
Gene Alias AGIF,IL-11
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGAACTGTGTTTGCCGCCTGGTCCTGGTCGTGCTGAGCCTGTGGCCAGATACAGCTGTCGCCCCTGGGCCACCACCTGGCCCCCCTCGAGTTTCCCCAGACCCTCGGGCCGAGCTGGACAGCACCGTGCTCCTGACCCGCTCTCTCCTGGCGGACACGCGGCAGCTGGCTGCACAGCTGAGGGACAAATTCCCAGCTGACGGGGACCACAACCTGGATTCCCTGCCCACCCTGGCCATGAGTGCGGGGGCACTGGGAGCTCTACAGCTCCCAGGTGTGCTGACAAGGCTGCGAGCGGACCTACTGTCCTACCTGCGGCACGTGCAGTGGCTGCGCCGGGCAGGTGGCTCTTCCCTGAAGACCCTGGAGCCCGAGCTGGGCACCCTGCAGGCCCGACTGGACCGGCTGCTGCGCCGGCTGCAGCTCCTGATGTCCCGCCTGGCCCTGCCCCAGCCACCCCCGGACCCGCCGGCGCCCCCGCTGGCGCCCCCCTCCTCAGCCTGGGGGGGCATCAGGGCCGCCCACGCCATCCTGGGGGGGCTGCACCTGACACTTGACTGGGCCGTGAGGGGACTGCTGCTGCTGAAGACTCGGCTGTGA
ORF Protein Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T56308-Ab Anti-IL11/ AGIF/ IL-11 functional antibody
    Target Antigen GM-Tg-g-T56308-Ag IL11 protein
    Cytokine cks-Tg-g-GM-T56308 interleukin 11 (IL11) protein & antibody
    ORF Viral Vector pGMLP003437 Human IL11 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-014 Human IL11 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-097 Human IL11 Adenovirus plasmid
    ORF Viral Vector vGMLP003437 Human IL11 Lentivirus particle
    ORF Viral Vector vGMLP-IL-014 Human IL11 Lentivirus particle
    ORF Viral Vector vGMAP-IL-097 Human IL11 Adenovirus particle


    Target information

    Target ID GM-T56308
    Target Name IL-11/IL11
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3589
    Gene ID 100056037 (Equus caballus), 100337295 (Bos taurus), 101085086 (Felis catus), 16156 (Mus musculus)
    171040 (Rattus norvegicus), 3589 (Homo sapiens), 611309 (Canis lupus familiaris), 722817 (Macaca mulatta)
    Gene Symbols & Synonyms IL11,Il11,IL-11,Il-11,AGIF
    Target Alternative Names AGIF,Adipogenesis inhibitory factor (AGIF),IL-11,IL11,Il-11,Il11,Interleukin-11
    Uniprot Accession P20809,P47873,Q99MF5
    Additional SwissProt Accessions: P47873,Q99MF5,P20809
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Hematopoietic cell lineage, Rheumatoid arthritis
    Gene Ensembl ENSECAG00000014511, ENSBTAG00000057283, ENSMUSG00000004371, ENSG00000095752, ENSCAFG00845000969
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.