Human IL10/CSIF/GVHDS ORF/cDNA clone-Adenovirus plasmid (NM_000572)
Cat. No.: pGMAP-IL-096
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL10/CSIF/GVHDS adenoviral expression plasmid for IL10 adenovirus packaging, IL10 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL-10/IL10/IL10/CSIF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP-IL-096 |
| Gene Name | IL10 |
| Accession Number | NM_000572 |
| Gene ID | 3586 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 537 bp |
| Gene Alias | CSIF,GVHDS,IL-10,IL10A,TGIF |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAGGGCCAGCCCAGGCCAGGGCACCCAGTCTGAGAACAGCTGCACCCACTTCCCAGGCAACCTGCCTAACATGCTTCGAGATCTCCGAGATGCCTTCAGCAGAGTGAAGACTTTCTTTCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAAGGAGTCCTTGCTGGAGGACTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCTGAGATGATCCAGTTTTACCTGGAGGAGGTGATGCCCCAAGCTGAGAACCAAGACCCAGACATCAAGGCGCATGTGAACTCCCTGGGGGAGAACCTGAAGACCCTCAGGCTGAGGCTACGGCGCTGTCATCGATTTCTTCCCTGTGAAAACAAGAGCAAGGCCGTGGAGCAGGTGAAGAATGCCTTTAATAAGCTCCAAGAGAAAGGCATCTACAAAGCCATGAGTGAGTTTGACATCTTCATCAACTACATAGAAGCCTACATGACAATGAAGATACGAAACTGA |
| ORF Protein Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T09092-Ab | Anti-IL10/ CSIF/ GVHDS functional antibody |
| Target Antigen | GM-Tg-g-T09092-Ag | IL10 protein |
| Cytokine | cks-Tg-g-GM-T09092 | interleukin 10 (IL10) protein & antibody |
| ORF Viral Vector | pGMLV001166 | Human IL-10 Lentivirus plasmid |
| ORF Viral Vector | pGMAD000014 | Human IL10 Adenovirus plasmid |
| ORF Viral Vector | pGMAP000484 | Human IL10 Adenovirus plasmid |
| ORF Viral Vector | pGMLP-IL-013 | Human IL10 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-096 | Human IL10 Adenovirus plasmid |
| ORF Viral Vector | pGMPC004770 | Human IL10 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLV001166 | Human IL-10 Lentivirus particle |
| ORF Viral Vector | vGMAD000014 | Human IL10 Adenovirus particle |
| ORF Viral Vector | vGMAP000484 | Human IL10 Adenovirus particle |
| ORF Viral Vector | vGMLP-IL-013 | Human IL10 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-096 | Human IL10 Adenovirus particle |
Target information
| Target ID | GM-T09092 |
| Target Name | IL-10/IL10 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3586 |
| Gene ID |
100034187 (Equus caballus), 16153 (Mus musculus), 25325 (Rattus norvegicus), 281246 (Bos taurus) 3586 (Homo sapiens), 403628 (Canis lupus familiaris), 493683 (Felis catus), 694931 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL10,Il10,IF2A,IL-10,CSIF,If2a,Il-10,IL10X,TGIF,GVHDS,IL10A |
| Target Alternative Names | CSIF,Cytokine synthesis inhibitory factor (CSIF),GVHDS,IF2A,IL-10,IL10,IL10A,IL10X,If2a,Il-10,Il10,Interleukin-10,TGIF |
| Uniprot Accession |
P18893,P22301,P29456,P43480,P48411,P51496,P55029,Q28374
Additional SwissProt Accessions: Q28374,P18893,P29456,P43480,P22301,P48411,P55029,P51496 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | cancer, Ovary Cancer, metastases, asthma, Malignant neoplasm of bladder |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, FoxO signaling pathway, C-type lectin receptor signaling pathway, JAK-STAT signaling pathway, T cell receptor signaling pathway, Intestinal immune network for IgA production, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Staphylococcus aureus infection, Tuberculosis, Asthma, Autoimmune thyroid disease, Inflammatory bowel disease, Allograft rejection |
| Gene Ensembl | ENSMUSG00000016529, ENSBTAG00000006685, ENSG00000136634, ENSCAFG00845001289, ENSMMUG00000023569 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


