Human IL1F10/FIL1-theta/FKSG75 ORF/cDNA clone-Adenovirus plasmid (NM_173161)
Cat. No.: pGMAP-IL-086
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL1F10/FIL1-theta/FKSG75 adenoviral expression plasmid for IL1F10 adenovirus packaging, IL1F10 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
IL-1F10/IL1F10/IL1F10/FIL1-theta products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAP-IL-086 |
| Gene Name | IL1F10 |
| Accession Number | NM_173161 |
| Gene ID | 84639 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 459 bp |
| Gene Alias | FIL1-theta,FKSG75,IL-1HY2,IL-38,IL1-theta,IL1HY2 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGTGTTCCCTCCCCATGGCAAGATACTACATAATTAAATATGCAGACCAGAAGGCTCTATACACAAGAGATGGCCAGCTGCTGGTGGGAGATCCTGTTGCAGACAACTGCTGTGCAGAGAAGATCTGCATACTTCCTAACAGAGGCTTGGCCCGCACCAAGGTCCCCATTTTCCTGGGGATCCAGGGAGGGAGCCGCTGCCTGGCATGTGTGGAGACAGAAGAGGGGCCTTCCCTACAGCTGGAGGATGTGAACATTGAGGAACTGTACAAAGGTGGTGAAGAGGCCACACGCTTCACCTTCTTCCAGAGCAGCTCAGGCTCCGCCTTCAGGCTTGAGGCTGCTGCCTGGCCTGGCTGGTTCCTGTGTGGCCCGGCAGAGCCCCAGCAGCCAGTACAGCTCACCAAGGAGAGTGAGCCCTCAGCCCGTACCAAGTTTTACTTTGAACAGAGCTGGTAG |
| ORF Protein Sequence | MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1024-Ab | Anti-IL1FA/ IL1F10/ FIL1-theta functional antibody |
| Target Antigen | GM-Tg-g-SE1024-Ag | IL1F10 protein |
| ORF Viral Vector | pGMLP-IL-003 | Human IL1F10 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-086 | Human IL1F10 Adenovirus plasmid |
| ORF Viral Vector | vGMLP-IL-003 | Human IL1F10 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-086 | Human IL1F10 Adenovirus particle |
Target information
| Target ID | GM-SE1024 |
| Target Name | IL-1F10/IL1F10 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
84639 |
| Gene ID |
100052532 (Equus caballus), 100428875 (Macaca mulatta), 101096973 (Felis catus), 215274 (Mus musculus) 362077 (Rattus norvegicus), 611873 (Canis lupus familiaris), 615702 (Bos taurus), 84639 (Homo sapiens) |
| Gene Symbols & Synonyms | IL1F10,Il1f10,IL-38,FKSG75,IL1HY2,IL-1HY2,IL1-theta,FIL1-theta |
| Target Alternative Names | FIL1-theta,FKSG75,Family of interleukin 1-theta (FIL1 theta),IL-1F10,IL-1HY2,IL-38,IL1-theta,IL1F10,IL1HY2,Il1f10,Interleukin-1 HY2 (IL-1HY2),Interleukin-1 family member 10,Interleukin-1 theta (IL-1 theta),Interleukin-38 (IL-38) |
| Uniprot Accession |
Q8R459,Q8WWZ1
Additional SwissProt Accessions: Q8R459,Q8WWZ1 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSECAG00000021901, ENSMMUG00000061530, ENSMUSG00000046845, ENSCAFG00845011918, ENSBTAG00000018012, ENSG00000136697 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


