Human CXCL6/CKA-3/GCP-2 ORF/cDNA clone-Adenovirus plasmid (NM_002993)
Cat. No.: pGMAD001587
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CXCL6/CKA-3/GCP-2 adenoviral expression plasmid for CXCL6 adenovirus packaging, CXCL6 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
CXCL6/CKA-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAD001587 |
| Gene Name | CXCL6 |
| Accession Number | NM_002993 |
| Gene ID | 6372 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 345 bp |
| Gene Alias | CKA-3,GCP-2,GCP2,SCYB6 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAGCCTCCCGTCCAGCCGCGCGGCCCGTGTCCCGGGTCCTTCGGGCTCCTTGTGCGCGCTGCTCGCGCTGCTGCTCCTGCTGACGCCGCCGGGGCCCCTCGCCAGCGCTGGTCCTGTCTCTGCTGTGCTGACAGAGCTGCGTTGCACTTGTTTACGCGTTACGCTGAGAGTAAACCCCAAAACGATTGGTAAACTGCAGGTGTTCCCCGCAGGCCCGCAGTGCTCCAAGGTGGAAGTGGTAGCCTCCCTGAAGAACGGGAAGCAAGTTTGTCTGGACCCGGAAGCCCCTTTTCTAAAGAAAGTCATCCAGAAAATTTTGGACAGTGGAAACAAGAAAAACTGA |
| ORF Protein Sequence | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0845-Ab | Anti-CXCL6/ CKA-3/ GCP-2 functional antibody |
| Target Antigen | GM-Tg-g-SE0845-Ag | CXCL6 protein |
| Cytokine | cks-Tg-g-GM-SE0845 | chemokine (C-X-C motif) ligand 6 (CXCL6) protein & antibody |
| ORF Viral Vector | pGMLP002324 | Human CXCL6 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001587 | Human CXCL6 Adenovirus plasmid |
| ORF Viral Vector | vGMLP002324 | Human CXCL6 Lentivirus particle |
| ORF Viral Vector | vGMAD001587 | Human CXCL6 Adenovirus particle |
Target information
| Target ID | GM-SE0845 |
| Target Name | CXCL6 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
6372 |
| Gene ID | 100033988 (Equus caballus), 60665 (Rattus norvegicus), 6372 (Homo sapiens), 704133 (Macaca mulatta) |
| Gene Symbols & Synonyms | CXCL6,Cxcl6,GCP2,Cxcl5,CKA-3,GCP-2,SCYB6 |
| Target Alternative Names | C-X-C motif chemokine 6,CKA-3,CXCL6,Chemokine alpha 3 (CKA-3),Cxcl5,Cxcl6,GCP-2,GCP2,Granulocyte chemotactic protein 2 (GCP-2),SCYB6,Small-inducible cytokine B6 |
| Uniprot Accession |
P80162,P97885,Q8MIN2
Additional SwissProt Accessions: Q8MIN2,P97885,P80162 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Pertussis, Rheumatoid arthritis |
| Gene Ensembl | ENSECAG00000012742, ENSG00000124875, ENSMMUG00000062421 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


