Human PPIA/CYPA/CYPH ORF/cDNA clone-Adenovirus plasmid (NM_021130.5)
Cat. No.: pGMAD001436
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PPIA/CYPA/CYPH adenoviral expression plasmid for PPIA adenovirus packaging, PPIA adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
Cyclophilin A/PPIA/PPIA/CYPA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAD001436 |
| Gene Name | PPIA |
| Accession Number | NM_021130.5 |
| Gene ID | 5478 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 498 bp |
| Gene Alias | CYPA,CYPH,HEL-S-69p |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | Null |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGTCAACCCCACCGTGTTCTTCGACATTGCCGTCGACGGCGAGCCCTTGGGCCGCGTCTCCTTTGAGCTGTTTGCAGACAAGGTCCCAAAGACAGCAGAAAATTTTCGTGCTCTGAGCACTGGAGAGAAAGGATTTGGTTATAAGGGTTCCTGCTTTCACAGAATTATTCCAGGGTTTATGTGTCAGGGTGGTGACTTCACACGCCATAATGGCACTGGTGGCAAGTCCATCTATGGGGAGAAATTTGAAGATGAGAACTTCATCCTAAAGCATACGGGTCCTGGCATCTTGTCCATGGCAAATGCTGGACCCAACACAAATGGTTCCCAGTTTTTCATCTGCACTGCCAAGACTGAGTGGTTGGATGGCAAGCATGTGGTGTTTGGCAAAGTGAAAGAAGGCATGAATATTGTGGAGGCCATGGAGCGCTTTGGGTCCAGGAATGGCAAGACCAGCAAGAAGATCACCATTGCTGACTGTGGACAACTCGAATAA |
| ORF Protein Sequence | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T47081-Ab | Anti-PPIA/ CYPA/ CYPH functional antibody |
| Target Antigen | GM-Tg-g-T47081-Ag | PPIA protein |
| ORF Viral Vector | pGMLV002304 | Human PPIA Lentivirus plasmid |
| ORF Viral Vector | pGMLV002305 | Human PPIA Lentivirus plasmid |
| ORF Viral Vector | pGMAD001436 | Human PPIA Adenovirus plasmid |
| ORF Viral Vector | pGMAD001443 | Human PPIA Adenovirus plasmid |
| ORF Viral Vector | pGMAP000039 | Human PPIA Adenovirus plasmid |
| ORF Viral Vector | vGMLV002304 | Human PPIA Lentivirus particle |
| ORF Viral Vector | vGMLV002305 | Human PPIA Lentivirus particle |
| ORF Viral Vector | vGMAD001436 | Human PPIA Adenovirus particle |
| ORF Viral Vector | vGMAD001443 | Human PPIA Adenovirus particle |
| ORF Viral Vector | vGMAP000039 | Human PPIA Adenovirus particle |
Target information
| Target ID | GM-T47081 |
| Target Name | Cyclophilin A/PPIA |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5478 |
| Gene ID |
100052020 (Equus caballus), 25518 (Rattus norvegicus), 268373 (Mus musculus), 281418 (Bos taurus) 493966 (Felis catus), 5478 (Homo sapiens), 574102 (Macaca mulatta), 608151 (Canis lupus familiaris) |
| Gene Symbols & Synonyms | PPIA,Ppia,p31,CYCA,CyP-A,p1B15,Cphn,CypA,SP18,CyP-18,ND1,cypA,MTND1,NADH1,MT-ND1,CYPA,CYPH,HEL-S-69p |
| Target Alternative Names | CYCA,CYPA,CYPH,Cphn,CyP-18,CyP-A,Cyclophilin A,Cyclosporin A-binding protein,CypA,HEL-S-69p,MT-ND1,MTND1,NADH1,ND1,PPIA,PPIase A,Peptidyl-prolyl cis-trans isomerase A,Ppia,Rotamase A,SP18,cypA,p1B15,p31 |
| Uniprot Accession |
P10111,P17742,P48900,Q8HXS3,P62935,P62937,P62940
Additional SwissProt Accessions: P10111,P17742,P62935,P48900,Q8HXS3,P62937,P62940 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000016673, ENSMUSG00000071866, ENSBTAG00000012003, ENSG00000196262, ENSMMUG00000016638 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


