Human FOSL1/FRA/fra-1 ORF/cDNA clone-Adenovirus plasmid (NM_005438.5)

Cat. No.: pGMAD001391
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FOSL1/FRA/fra-1 adenoviral expression plasmid for FOSL1 adenovirus packaging, FOSL1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FOSL1/FRA products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD001391
Gene Name FOSL1
Accession Number NM_005438.5
Gene ID 8061
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 816 bp
Gene Alias FRA,fra-1,FRA1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGAAGTTCCACCTGGTGCCAAGCATCAACACCATGAGTGGCAGTCAGGAGCTGCAGTGGATGGTACAGCCTCATTTCCTGGGGCCCAGCAGTTACCCCAGGCCTCTGACCTACCCTCAGTACAGCCCCCCACAACCCCGGCCAGGAGTCATCCGGGCCCTGGGGCCGCCTCCAGGGGTACGTCGAAGGCCTTGTGAACAGATCAGCCCGGAGGAAGAGGAGCGCCGCCGAGTAAGGCGCGAGCGGAACAAGCTGGCTGCGGCCAAGTGCAGGAACCGGAGGAAGGAACTGACCGACTTCCTGCAGGCGGAGACTGACAAACTGGAAGATGAGAAATCTGGGCTGCAGCGAGAGATTGAGGAGCTGCAGAAGCAGAAGGAGCGCCTAGAGCTGGTGCTGGAAGCCCACCGACCCATCTGCAAAATCCCGGAAGGAGCCAAGGAGGGGGACACAGGCAGTACCAGTGGCACCAGCAGCCCACCAGCCCCCTGCCGCCCTGTACCTTGTATCTCCCTTTCCCCAGGGCCTGTGCTTGAACCTGAGGCACTGCACACCCCCACACTCATGACCACACCCTCCCTAACTCCTTTCACCCCCAGCCTGGTCTTCACCTACCCCAGCACTCCTGAGCCTTGTGCCTCAGCTCATCGCAAGAGTAGCAGCAGCAGCGGAGACCCATCCTCTGACCCCCTTGGCTCTCCAACCCTCCTCGCTTTGTGA
ORF Protein Sequence MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T89299-Ab Anti-FOSL1 monoclonal antibody
    Target Antigen GM-Tg-g-T89299-Ag FOSL1 protein
    ORF Viral Vector pGMLP002676 Human FOSL1 Lentivirus plasmid
    ORF Viral Vector pGMLV001888 Human FOSL1 Lentivirus plasmid
    ORF Viral Vector pGMLV002226 Human FOSL1 Lentivirus plasmid
    ORF Viral Vector pGMAD001391 Human FOSL1 Adenovirus plasmid
    ORF Viral Vector vGMLP002676 Human FOSL1 Lentivirus particle
    ORF Viral Vector vGMLV001888 Human FOSL1 Lentivirus particle
    ORF Viral Vector vGMLV002226 Human FOSL1 Lentivirus particle
    ORF Viral Vector vGMAD001391 Human FOSL1 Adenovirus particle


    Target information

    Target ID GM-T89299
    Target Name FOSL1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8061
    Gene ID 100051930 (Equus caballus), 101101337 (Felis catus), 106993191 (Macaca mulatta), 14283 (Mus musculus)
    25445 (Rattus norvegicus), 483724 (Canis lupus familiaris), 531389 (Bos taurus), 8061 (Homo sapiens)
    Gene Symbols & Synonyms FOSL1,Fosl1,Fra1,fra-1,Fra-1,FRA,FRA1
    Target Alternative Names FOSL1,Fos-related antigen 1,FRA-1,FRA,FRA1,fra-1
    Uniprot Accession P10158,P15407,P48755
    Additional SwissProt Accessions: P48755,P10158,P15407
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Wnt signaling pathway, Osteoclast differentiation, IL-17 signaling pathway, Human T-cell leukemia virus 1 infection
    Gene Ensembl ENSECAG00000023092, ENSMMUG00000008653, ENSMUSG00000024912, ENSCAFG00845017398, ENSBTAG00000006194, ENSG00000175592
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.