Human MIF/GIF/GLIF ORF/cDNA clone-Adenovirus plasmid (NM_002415.1)

Cat. No.: pGMAD001167
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MIF/GIF/GLIF adenoviral expression plasmid for MIF adenovirus packaging, MIF adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MIF/GIF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD001167
Gene Name MIF
Accession Number NM_002415.1
Gene ID 4282
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 348 bp
Gene Alias GIF,GLIF,MMIF
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCACCCAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTGCACGTGGTCCCGGACCAGCTCATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGCGCGCAGAACCGCTCCTACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACAGGGTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCCTAA
ORF Protein Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-265 Pre-Made Imalumab biosimilar, Whole mAb, Anti-MIF Antibody: Anti-GIF/GLIF/MMIF therapeutic antibody
    Target Antibody GM-Tg-g-T39977-Ab Anti-MIF/ GIF/ GLIF monoclonal antibody
    Target Antigen GM-Tg-g-T39977-Ag MIF VLP (virus-like particle)
    ORF Viral Vector pGMLP001966 Human MIF Lentivirus plasmid
    ORF Viral Vector pGMAD001167 Human MIF Adenovirus plasmid
    ORF Viral Vector vGMLP001966 Human MIF Lentivirus particle
    ORF Viral Vector vGMAD001167 Human MIF Adenovirus particle


    Target information

    Target ID GM-T39977
    Target Name MIF
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4282
    Gene ID 100053618 (Equus caballus), 101090298 (Felis catus), 17319 (Mus musculus), 280858 (Bos taurus)
    4282 (Homo sapiens), 574298 (Macaca mulatta), 595146 (Canis lupus familiaris), 81683 (Rattus norvegicus)
    Gene Symbols & Synonyms MIF,Mif,MMIF,GIF,DER6,Glif,GLIF
    Target Alternative Names DER6,GIF,GLIF,Glif,Glycosylation-inhibiting factor (GIF),L-dopachrome isomerase,L-dopachrome tautomerase,MIF,MMIF,Macrophage migration inhibitory factor,Mif,Phenylpyruvate tautomerase
    Uniprot Accession P14174,P30904,P34884,P80177,Q6DN04
    Additional SwissProt Accessions: P34884,P80177,P14174,Q6DN04,P30904
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer, Ovary Cancer, Kidney transplant rejection, Congenital occlusion of ureteropelvic junction, Sepsis
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSMUSG00000033307, ENSBTAG00000007375, ENSG00000240972, ENSMMUG00000009106, ENSCAFG00845024852
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.