Human JUN/AP-1/AP1 ORF/cDNA clone-Adenovirus plasmid (NM_002228.4)

Cat. No.: pGMAD000912
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human JUN/AP-1/AP1 adenoviral expression plasmid for JUN adenovirus packaging, JUN adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to JUN/AP-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000912
Gene Name JUN
Accession Number NM_002228.4
Gene ID 3725
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 996 bp
Gene Alias AP-1,AP1,c-Jun,cJUN,p39
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGACTGCAAAGATGGAAACGACCTTCTATGACGATGCCCTCAACGCCTCGTTCCTCCCGTCCGAGAGCGGACCTTATGGCTACAGTAACCCCAAGATCCTGAAACAGAGCATGACCCTGAACCTGGCCGACCCAGTGGGGAGCCTGAAGCCGCACCTCCGCGCCAAGAACTCGGACCTCCTCACCTCGCCCGACGTGGGGCTGCTCAAGCTGGCGTCGCCCGAGCTGGAGCGCCTGATAATCCAGTCCAGCAACGGGCACATCACCACCACGCCGACCCCCACCCAGTTCCTGTGCCCCAAGAACGTGACAGATGAGCAGGAGGGCTTCGCCGAGGGCTTCGTGCGCGCCCTGGCCGAACTGCACAGCCAGAACACGCTGCCCAGCGTCACGTCGGCGGCGCAGCCGGTCAACGGGGCAGGCATGGTGGCTCCCGCGGTAGCCTCGGTGGCAGGGGGCAGCGGCAGCGGCGGCTTCAGCGCCAGCCTGCACAGCGAGCCGCCGGTCTACGCAAACCTCAGCAACTTCAACCCAGGCGCGCTGAGCAGCGGCGGCGGGGCGCCCTCCTACGGCGCGGCCGGCCTGGCCTTTCCCGCGCAACCCCAGCAGCAGCAGCAGCCGCCGCACCACCTGCCCCAGCAGATGCCCGTGCAGCACCCGCGGCTGCAGGCCCTGAAGGAGGAGCCTCAGACAGTGCCCGAGATGCCCGGCGAGACACCGCCCCTGTCCCCCATCGACATGGAGTCCCAGGAGCGGATCAAGGCGGAGAGGAAGCGCATGAGGAACCGCATCGCTGCCTCCAAGTGCCGAAAAAGGAAGCTGGAGAGAATCGCCCGGCTGGAGGAAAAAGTGAAAACCTTGAAAGCTCAGAACTCGGAGCTGGCGTCCACGGCCAACATGCTCAGGGAACAGGTGGCACAGCTTAAACAGAAAGTCATGAACCACGTTAACAGTGGGTGCCAACTCATGCTAACGCAGCAGTTGCAAACATTTTGA
ORF Protein Sequence MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T69085-Ab Anti-JUN monoclonal antibody
    Target Antigen GM-Tg-g-T69085-Ag JUN protein
    ORF Viral Vector pGMLP005587 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMLV000295 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMLV001471 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMAD000140 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMAD000912 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMAD001483 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMAP000535 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-129 Human JUN Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-269 Human JUN Adenovirus plasmid
    ORF Viral Vector pGMPC000142 Human JUN Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005587 Human JUN Lentivirus particle
    ORF Viral Vector vGMLV000295 Human JUN Lentivirus particle
    ORF Viral Vector vGMLV001471 Human JUN Lentivirus particle
    ORF Viral Vector vGMAD000140 Human JUN Adenovirus particle
    ORF Viral Vector vGMAD000912 Human JUN Adenovirus particle
    ORF Viral Vector vGMAD001483 Human JUN Adenovirus particle
    ORF Viral Vector vGMAP000535 Human JUN Adenovirus particle
    ORF Viral Vector vGMLP-SPh-129 Human JUN Lentivirus particle
    ORF Viral Vector vGMAP-SPh-269 Human JUN Adenovirus particle


    Target information

    Target ID GM-T69085
    Target Name JUN
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3725
    Gene ID 100067469 (Equus caballus), 101097261 (Felis catus), 16476 (Mus musculus), 24516 (Rattus norvegicus)
    280831 (Bos taurus), 3725 (Homo sapiens), 609429 (Canis lupus familiaris), 716452 (Macaca mulatta)
    Gene Symbols & Synonyms JUN,Jun,AP-1,Junc,c-jun,AP1,p39,cJUN,c-Jun
    Target Alternative Names AP-1,AP1,Activator protein 1 (AP1),JUN,Jun,Junc,Proto-oncogene c-Jun,Transcription factor AP-1 subunit Jun,Transcription factor Jun,V-jun avian sarcoma virus 17 oncogene homolog,c-Jun,c-jun,cJUN,p39
    Uniprot Accession O77627,P05412,P05627,P17325
    Additional SwissProt Accessions: P05627,P17325,O77627,P05412
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Endocrine resistance, MAPK signaling pathway, ErbB signaling pathway, cAMP signaling pathway, Apoptosis, Wnt signaling pathway, Osteoclast differentiation, Focal adhesion, Tight junction, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, TNF signaling pathway, Neurotrophin signaling pathway, GnRH signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Cocaine addiction, Amphetamine addiction, Epithelial cell signaling in Helicobacter pylori infection, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Hepatitis B, Measles, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Renal cell carcinoma, Breast cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Inflammatory bowel disease, Rheumatoid arthritis, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000024055, ENSMUSG00000052684, ENSG00000177606, ENSCAFG00845006541, ENSMMUG00000059326
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.