Human FCER1G/FCRG ORF/cDNA clone-Adenovirus plasmid (NM_004106.2)

Cat. No.: pGMAD000910
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FCER1G/FCRG adenoviral expression plasmid for FCER1G adenovirus packaging, FCER1G adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to FcRγ/FCER1G/FCERG/FCER1G/FCRG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000910
Gene Name FCER1G
Accession Number NM_004106.2
Gene ID 2207
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 261 bp
Gene Alias FCRG
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAGTAG
ORF Protein Sequence MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T95400-Ab Anti-FCERG/ FCER1G/ FCRG monoclonal antibody
    Target Antigen GM-Tg-g-T95400-Ag FCERG/FCER1G VLP (virus-like particle)
    ORF Viral Vector pGMLP004456 Human FCER1G Lentivirus plasmid
    ORF Viral Vector pGMAD000910 Human FCER1G Adenovirus plasmid
    ORF Viral Vector vGMLP004456 Human FCER1G Lentivirus particle
    ORF Viral Vector vGMAD000910 Human FCER1G Adenovirus particle


    Target information

    Target ID GM-T95400
    Target Name FcRγ/FCER1G/FCERG
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2207
    Gene ID 100034137 (Equus caballus), 101089236 (Felis catus), 14127 (Mus musculus), 2207 (Homo sapiens)
    25441 (Rattus norvegicus), 282226 (Bos taurus), 403798 (Canis lupus familiaris), 720291 (Macaca mulatta)
    Gene Symbols & Synonyms FCER1G,Fcer1g,CD23,Fce1g,Ly-50,FcR[g],FcRgamma,FcR-gamma,FcepsilonRI,FCRG
    Target Alternative Names CD23,FCER1G,FCERG,FCRG,Fc receptor gamma-chain (FcRgamma),Fc-epsilon RI-gamma,FcR-gamma,FcR[g],FcRgamma,FcRγ,Fce1g,FcepsilonRI,Fcer1g,High affinity immunoglobulin epsilon receptor subunit gamma,IgE Fc receptor subunit gamma (FceRI gamma),Ly-50
    Uniprot Accession P20411,P20491,P30273,Q9BDR7
    Additional SwissProt Accessions: P20491,P30273,P20411,Q9BDR7
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Sphingolipid signaling pathway, Phospholipase D signaling pathway, Platelet activation, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, Fc epsilon RI signaling pathway, Tuberculosis, Asthma
    Gene Ensembl ENSMUSG00000058715, ENSG00000158869, ENSBTAG00000024503, ENSCAFG00845029387, ENSMMUG00000004512
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.