Human WNT1/BMND16/INT1 ORF/cDNA clone-Adenovirus plasmid (NM_005430.3)

Cat. No.: pGMAD000604
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human WNT1/BMND16/INT1 adenoviral expression plasmid for WNT1 adenovirus packaging, WNT1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to WNT1/BMND16 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000604
Gene Name WNT1
Accession Number NM_005430.3
Gene ID 7471
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 1113 bp
Gene Alias BMND16,INT1,OI15
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGGGCTCTGGGCGCTGTTGCCTGGCTGGGTTTCTGCTACGCTGCTGCTGGCGCTGGCCGCTCTGCCCGCAGCCCTGGCTGCCAACAGCAGTGGCCGATGGTGGGGTATTGTGAACGTAGCCTCCTCCACGAACCTGCTTACAGACTCCAAGAGTCTGCAACTGGTACTCGAGCCCAGTCTGCAGCTGTTGAGCCGCAAACAGCGGCGTCTGATACGCCAAAATCCGGGGATCCTGCACAGCGTGAGTGGGGGGCTGCAGAGTGCCGTGCGCGAGTGCAAGTGGCAGTTCCGGAATCGCCGCTGGAACTGTCCCACTGCTCCAGGGCCCCACCTCTTCGGCAAGATCGTCAACCGAGGCTGTCGAGAAACGGCGTTTATCTTCGCTATCACCTCCGCCGGGGTCACCCATTCGGTGGCGCGCTCCTGCTCAGAAGGTTCCATCGAATCCTGCACGTGTGACTACCGGCGGCGCGGCCCCGGGGGCCCCGACTGGCACTGGGGGGGCTGCAGCGACAACATTGACTTCGGCCGCCTCTTCGGCCGGGAGTTCGTGGACTCCGGGGAGAAGGGGCGGGACCTGCGCTTCCTCATGAACCTTCACAACAACGAGGCAGGCCGTACGACCGTATTCTCCGAGATGCGCCAGGAGTGCAAGTGCCACGGGATGTCCGGCTCATGCACGGTGCGCACGTGCTGGATGCGGCTGCCCACGCTGCGCGCCGTGGGCGATGTGCTGCGCGACCGCTTCGACGGCGCCTCGCGCGTCCTGTACGGCAACCGCGGCAGCAACCGCGCTTCGCGGGCGGAGCTGCTGCGCCTGGAGCCGGAAGACCCGGCCCACAAACCGCCCTCCCCCCACGACCTCGTCTACTTCGAGAAATCGCCCAACTTCTGCACGTACAGCGGACGCCTGGGCACAGCAGGCACGGCAGGGCGCGCCTGTAACAGCTCGTCGCCCGCGCTGGACGGCTGCGAGCTGCTCTGCTGCGGCAGGGGCCACCGCACGCGCACGCAGCGCGTCACCGAGCGCTGCAACTGCACCTTCCACTGGTGCTGCCACGTCAGCTGCCGCAACTGCACGCACACGCGCGTACTGCACGAGTGTCTGTGA
ORF Protein Sequence MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1934-Ab Anti-WNT1/ BMND16/ INT1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1934-Ag WNT1 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-MP1934 wingless-type MMTV integration site family, member 1 (WNT1) protein & antibody
    ORF Viral Vector pGMLP002016 Human WNT1 Lentivirus plasmid
    ORF Viral Vector pGMLP005580 Human WNT1 Lentivirus plasmid
    ORF Viral Vector pGMAD000604 Human WNT1 Adenovirus plasmid
    ORF Viral Vector vGMLP002016 Human WNT1 Lentivirus particle
    ORF Viral Vector vGMLP005580 Human WNT1 Lentivirus particle
    ORF Viral Vector vGMAD000604 Human WNT1 Adenovirus particle


    Target information

    Target ID GM-MP1934
    Target Name WNT1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7471
    Gene ID 100058859 (Equus caballus), 101094190 (Felis catus), 22408 (Mus musculus), 24881 (Rattus norvegicus)
    486560 (Canis lupus familiaris), 540662 (Bos taurus), 709009 (Macaca mulatta), 7471 (Homo sapiens)
    Gene Symbols & Synonyms WNT1,Wnt1,sw,Int-1,Wnt-1,swaying,Int1,INT1,OI15,BMND16
    Target Alternative Names BMND16,INT1,Int-1,Int1,OI15,Proto-oncogene Int-1 homolog,Proto-oncogene Wnt-1,WNT1,Wnt-1,Wnt1,sw,swaying
    Uniprot Accession P04426,P04628
    Additional SwissProt Accessions: P04426,P04628
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Cytokine Target
    Disease cancer
    Disease from KEGG Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Alzheimer disease, Human papillomavirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer
    Gene Ensembl ENSECAG00000009064, ENSMUSG00000022997, ENSCAFG00845022557, ENSBTAG00000015364, ENSMMUG00000015709, ENSG00000125084
    Target Classification Pathway, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.