Human AGR3/AG-3/AG3 ORF/cDNA clone-Adenovirus plasmid (NM_176813.4)
Cat. No.: pGMAD000483
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human AGR3/AG-3/AG3 adenoviral expression plasmid for AGR3 adenovirus packaging, AGR3 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
AGR3/AG-3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAD000483 |
| Gene Name | AGR3 |
| Accession Number | NM_176813.4 |
| Gene ID | 155465 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 501 bp |
| Gene Alias | AG-3,AG3,BCMP11,hAG-3,HAG3,PDIA18 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGATGCTACACTCAGCTTTGGGTCTCTGCCTCTTACTCGTCACAGTTTCTTCCAACCTTGCCATTGCAATAAAAAAGGAAAAGAGGCCTCCTCAGACACTCTCAAGAGGATGGGGAGATGACATCACTTGGGTACAAACTTATGAAGAAGGTCTCTTTTATGCTCAAAAAAGTAAGAAGCCATTAATGGTTATTCATCACCTGGAGGATTGTCAATACTCTCAAGCACTAAAGAAAGTATTTGCCCAAAATGAAGAAATACAAGAAATGGCTCAGAATAAGTTCATCATGCTAAACCTTATGCATGAAACCACTGATAAGAATTTATCACCTGATGGGCAATATGTGCCTAGAATCATGTTTGTAGACCCTTCTTTAACAGTTAGAGCTGACATAGCTGGAAGATACTCTAACAGATTGTACACATATGAGCCTCGGGATTTACCCCTATTGATAGAAAACATGAAGAAAGCATTAAGACTTATTCAGTCAGAGCTATAA |
| ORF Protein Sequence | MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1605-Ab | Anti-AGR3/ AG-3/ AG3 functional antibody |
| Target Antigen | GM-Tg-g-SE1605-Ag | AGR3 protein |
| ORF Viral Vector | pGMLP003206 | Human AGR3 Lentivirus plasmid |
| ORF Viral Vector | pGMAD000483 | Human AGR3 Adenovirus plasmid |
| ORF Viral Vector | vGMLP003206 | Human AGR3 Lentivirus particle |
| ORF Viral Vector | vGMAD000483 | Human AGR3 Adenovirus particle |
Target information
| Target ID | GM-SE1605 |
| Target Name | AGR3 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
155465 |
| Gene ID |
100066130 (Equus caballus), 155465 (Homo sapiens), 298959 (Rattus norvegicus), 403205 (Mus musculus) 618371 (Bos taurus), 714517 (Macaca mulatta) |
| Gene Symbols & Synonyms | AGR3,Agr3,AG3,AG-3,HAG3,hAG-3,BCMP11,PDIA18,RGD1565406,Gm888,E030025L21Rik |
| Target Alternative Names | AG-3,AG3,AGR3,Agr3,Anterior gradient 3 homolog,Anterior gradient protein 3,BCMP11,Breast cancer membrane protein 11,E030025L21Rik,Gm888,HAG3,PDIA18,Protein disulfide isomerase family A,RGD1565406,hAG-3,member 18 |
| Uniprot Accession |
Q8R3W7,Q8TD06
Additional SwissProt Accessions: Q8TD06,Q8R3W7 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000012283, ENSG00000173467, ENSMUSG00000036231, ENSBTAG00000045578, ENSMMUG00000016017 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


