Human AGR3/AG-3/AG3 ORF/cDNA clone-Adenovirus plasmid (NM_176813.4)

Cat. No.: pGMAD000483
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AGR3/AG-3/AG3 adenoviral expression plasmid for AGR3 adenovirus packaging, AGR3 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to AGR3/AG-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000483
Gene Name AGR3
Accession Number NM_176813.4
Gene ID 155465
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 501 bp
Gene Alias AG-3,AG3,BCMP11,hAG-3,HAG3,PDIA18
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGATGCTACACTCAGCTTTGGGTCTCTGCCTCTTACTCGTCACAGTTTCTTCCAACCTTGCCATTGCAATAAAAAAGGAAAAGAGGCCTCCTCAGACACTCTCAAGAGGATGGGGAGATGACATCACTTGGGTACAAACTTATGAAGAAGGTCTCTTTTATGCTCAAAAAAGTAAGAAGCCATTAATGGTTATTCATCACCTGGAGGATTGTCAATACTCTCAAGCACTAAAGAAAGTATTTGCCCAAAATGAAGAAATACAAGAAATGGCTCAGAATAAGTTCATCATGCTAAACCTTATGCATGAAACCACTGATAAGAATTTATCACCTGATGGGCAATATGTGCCTAGAATCATGTTTGTAGACCCTTCTTTAACAGTTAGAGCTGACATAGCTGGAAGATACTCTAACAGATTGTACACATATGAGCCTCGGGATTTACCCCTATTGATAGAAAACATGAAGAAAGCATTAAGACTTATTCAGTCAGAGCTATAA
ORF Protein Sequence MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1605-Ab Anti-AGR3/ AG-3/ AG3 functional antibody
    Target Antigen GM-Tg-g-SE1605-Ag AGR3 protein
    ORF Viral Vector pGMLP003206 Human AGR3 Lentivirus plasmid
    ORF Viral Vector pGMAD000483 Human AGR3 Adenovirus plasmid
    ORF Viral Vector vGMLP003206 Human AGR3 Lentivirus particle
    ORF Viral Vector vGMAD000483 Human AGR3 Adenovirus particle


    Target information

    Target ID GM-SE1605
    Target Name AGR3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		155465
    Gene ID 100066130 (Equus caballus), 155465 (Homo sapiens), 298959 (Rattus norvegicus), 403205 (Mus musculus)
    618371 (Bos taurus), 714517 (Macaca mulatta)
    Gene Symbols & Synonyms AGR3,Agr3,AG3,AG-3,HAG3,hAG-3,BCMP11,PDIA18,RGD1565406,Gm888,E030025L21Rik
    Target Alternative Names AG-3,AG3,AGR3,Agr3,Anterior gradient 3 homolog,Anterior gradient protein 3,BCMP11,Breast cancer membrane protein 11,E030025L21Rik,Gm888,HAG3,PDIA18,Protein disulfide isomerase family A,RGD1565406,hAG-3,member 18
    Uniprot Accession Q8R3W7,Q8TD06
    Additional SwissProt Accessions: Q8TD06,Q8R3W7
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000012283, ENSG00000173467, ENSMUSG00000036231, ENSBTAG00000045578, ENSMMUG00000016017
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.