Human TMEM215 ORF/cDNA clone-Adenovirus plasmid (NM_212558.2)

Cat. No.: pGMAD000411
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMEM215/ adenoviral expression plasmid for TMEM215 adenovirus packaging, TMEM215 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TMEM215 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000411
Gene Name TMEM215
Accession Number NM_212558.2
Gene ID 401498
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 708 bp
Gene Alias
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGCCTGATGACATTAACCCGAGGACTGGGCTGGTGGTGGCCCTGGTCAGTGTCTTCCTCGTCTTTGGTTTCATGTTCACCGTCTCTGGGATGAAAGGGGAGACTTTGGGAAACATCCCCCTCCTGGCCATCGGGCCAGCCATCTGCCTACCAGGCATCGCAGCCATTGCCCTGGCCAGGAAAACCGAGGGATGCACCAAGTGGCCAGAGAACGAGCTGCTGTGGGTCCGCAAATTGCCCTGCTTCCGGAAACCCAAAGACAAGGAGGTGGTAGAGCTGCTGAGGACCCCTTCAGACCTAGAATCCGGCAAGGGGAGCTCAGATGAGCTGGCTAAGAAGGCGGGCCTCAGGGGGAAGCCTCCCCCACAAAGCCAGGGTGAGGTGTCCGTGGCCAGCTCCATCAACAGCCCCACACCCACGGAGGAAGGAGAATGCCAGAGCCTCGTCCAGAATGGGCATCAGGAGGAGACGTCCAGATACCTGGACGGCTACTGCCCCTCGGGCAGTTCCCTCACCTACAGTGCCTTGGACGTCAAGTGCTCAGCAAGGGACAGATCTGAGTGCCCTGAGCCTGAGGATAGCATCTTCTTTGTGCCCCAGGACAGTATCATCGTTTGCTCCTACAAGCAGAACAGCCCGTATGACAGATACTGTTGTTATATCAATCAGATACAAGGCAGGTGGGACCACGAGACCATCGTCTAA
ORF Protein Sequence MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALARKTEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTPTEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETIV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2049-Ab Anti-TMEM215 monoclonal antibody
    Target Antigen GM-Tg-g-IP2049-Ag TMEM215 protein
    ORF Viral Vector pGMLP003472 Human TMEM215 Lentivirus plasmid
    ORF Viral Vector pGMAD000411 Human TMEM215 Adenovirus plasmid
    ORF Viral Vector pGMAD000723 Human TMEM215 Adenovirus plasmid
    ORF Viral Vector vGMLP003472 Human TMEM215 Lentivirus particle
    ORF Viral Vector vGMAD000411 Human TMEM215 Adenovirus particle
    ORF Viral Vector vGMAD000723 Human TMEM215 Adenovirus particle


    Target information

    Target ID GM-IP2049
    Target Name TMEM215
    Gene Group Identifier
    （Target Gene ID in Homo species)         		401498
    Gene ID 100053699 (Equus caballus), 101097185 (Felis catus), 320500 (Mus musculus), 401498 (Homo sapiens)
    510133 (Bos taurus), 611763 (Canis lupus familiaris), 690918 (Rattus norvegicus), 704427 (Macaca mulatta)
    Gene Symbols & Synonyms TMEM215,Tmem215,A930001M12Rik
    Target Alternative Names A930001M12Rik,TMEM215,Tmem215,Transmembrane protein 215
    Uniprot Accession A7E1Z1,A7MB05,Q68D42
    Additional SwissProt Accessions: A7E1Z1,Q68D42,A7MB05
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000004732, ENSMUSG00000046593, ENSG00000188133, ENSBTAG00000013974, ENSCAFG00845019629, ENSMMUG00000053668
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.