Human FGF23/ADHR/FGFN ORF/cDNA clone-Adenovirus plasmid (NM_020638.2)

Cat. No.: pGMAD000303
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF23/ADHR/FGFN adenoviral expression plasmid for FGF23 adenovirus packaging, FGF23 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF-23/FGF23/FGF23/ADHR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000303
Gene Name FGF23
Accession Number NM_020638.2
Gene ID 8074
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 756 bp
Gene Alias ADHR,FGFN,HPDR2,HYPF,PHPTC
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTTGGGGGCCCGCCTCAGGCTCTGGGTCTGTGCCTTGTGCAGCGTCTGCAGCATGAGCGTCCTCAGAGCCTATCCCAATGCCTCCCCACTGCTCGGCTCCAGCTGGGGTGGCCTGATCCACCTGTACACAGCCACAGCCAGGAACAGCTACCACCTGCAGATCCACAAGAATGGCCATGTGGATGGCGCACCCCATCAGACCATCTACAGTGCCCTGATGATCAGATCAGAGGATGCTGGCTTTGTGGTGATTACAGGTGTGATGAGCAGAAGATACCTCTGCATGGATTTCAGAGGCAACATTTTTGGATCACACTATTTCGACCCGGAGAACTGCAGGTTCCAACACCAGACGCTGGAAAACGGGTACGACGTCTACCACTCTCCTCAGTATCACTTCCTGGTCAGTCTGGGCCGGGCGAAGAGAGCCTTCCTGCCAGGCATGAACCCACCCCCGTACTCCCAGTTCCTGTCCCGGAGGAACGAGATCCCCCTAATTCACTTCAACACCCCCATACCACGGCGGCACACCCGGAGCGCCGAGGACGACTCGGAGCGGGACCCCCTGAACGTGCTGAAGCCCCGGGCCCGGATGACCCCGGCCCCGGCCTCCTGTTCACAGGAGCTCCCGAGCGCCGAGGACAACAGCCCGATGGCCAGTGACCCATTAGGGGTGGTCAGGGGCGGTCGAGTGAACACGCACGCTGGGGGAACGGGCCCGGAAGGCTGCCGCCCCTTCGCCAAGTTCATCTAG
ORF Protein Sequence MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-086 Pre-Made Burosumab biosimilar, Whole mAb, Anti-FGF23 Antibody: Anti-ADHR/FGFN/HFTC2/HPDR2/HYPF/PHPTC therapeutic antibody
    Target Antibody GM-Tg-g-T14853-Ab Anti-FGF23/ ADHR/ FGFN functional antibody
    Target Antigen GM-Tg-g-T14853-Ag FGF23 protein
    Cytokine cks-Tg-g-GM-T14853 fibroblast growth factor 23 (FGF23) protein & antibody
    ORF Viral Vector pGMLV002454 Human FGF23 Lentivirus plasmid
    ORF Viral Vector pGMAD000303 Human FGF23 Adenovirus plasmid
    ORF Viral Vector pGMAD001005 Human FGF23 Adenovirus plasmid
    ORF Viral Vector pGMPC001426 Human FGF23 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV002454 Human FGF23 Lentivirus particle
    ORF Viral Vector vGMAD000303 Human FGF23 Adenovirus particle
    ORF Viral Vector vGMAD001005 Human FGF23 Adenovirus particle


    Target information

    Target ID GM-T14853
    Target Name FGF-23/FGF23
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8074
    Gene ID 100058460 (Equus caballus), 101100063 (Felis catus), 170583 (Rattus norvegicus), 530239 (Bos taurus)
    611773 (Canis lupus familiaris), 64654 (Mus musculus), 710643 (Macaca mulatta), 8074 (Homo sapiens)
    Gene Symbols & Synonyms FGF23,Fgf23,FGF8B,Fgf8b,ADHR,FGFN,HYPF,HFTC2,HPDR2,PHPTC
    Target Alternative Names ADHR,FGF-23,FGF23,FGF8B,FGFN,Fgf23,Fgf8b,Fibroblast growth factor 23,HFTC2,HPDR2,HYPF,PHPTC,Phosphatonin,Tumor-derived hypophosphatemia-inducing factor
    Uniprot Accession Q8VI82,Q9EPC2,Q9GZV9
    Additional SwissProt Accessions: Q8VI82,Q9EPC2,Q9GZV9
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease cancer, Hypertension, Localized osteoporosis [Lequesne]
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Parathyroid hormone synthesis, secretion and action, Pathways in cancer, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSBTAG00000030343, ENSCAFG00845030660, ENSMUSG00000000182, ENSMMUG00000064833, ENSG00000118972
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.