Human FGF2/BFGF/FGF-2 ORF/cDNA clone-Adenovirus plasmid (NM_002006)

Cat. No.: pGMAD000136
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF2/BFGF/FGF-2 adenoviral expression plasmid for FGF2 adenovirus packaging, FGF2 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF2/BFGF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000136
Gene Name FGF2
Accession Number NM_002006
Gene ID 2247
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 867 bp
Gene Alias BFGF,FGF-2,FGFB,HBGF-2
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAGATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCGGCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCCGGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGGGACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGTGCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCTCCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAGGACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGCCGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACATCAAGCTACAACTTCAAGCAGAAGAGAGAGGAGTTGTGTCTATCAAAGGAGTGTGTGCTAACCGTTACCTGGCTATGAAGGAAGATGGAAGATTACTGGCTTCTAAATGTGTTACGGATGAGTGTTTCTTTTTTGAACGATTGGAATCTAATAACTACAATACTTACCGGTCAAGGAAATACACCAGTTGGTATGTGGCACTGAAACGAACTGGGCAGTATAAACTTGGATCCAAAACAGGACCTGGGCAGAAAGCTATACTTTTTCTTCCAATGTCTGCTAAGAGCTGA
ORF Protein Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-820 Pre-Made Eflimrufusp Alfa Biosimilar, Fusion Protein targeting FGF2 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting BFGF/FGF-2/FGFB/HBGF-2
    Biosimilar GMP-Bios-INN-969 Pre-Made Recifercept biosimilar, Recombinant Protein: Recombinant therapeutic protein targeting FGF
    Target Antibody GM-Tg-g-T31621-Ab Anti-FGF2/ BFGF/ FGF-2 functional antibody
    Target Antigen GM-Tg-g-T31621-Ag FGF2 protein
    Cytokine cks-Tg-g-GM-T31621 fibroblast growth factor 2 (basic) (FGF2) protein & antibody
    ORF Viral Vector pGMLV000801 Human FGF2 Lentivirus plasmid
    ORF Viral Vector pGMAD000136 Human FGF2 Adenovirus plasmid
    ORF Viral Vector vGMLV000801 Human FGF2 Lentivirus particle
    ORF Viral Vector vGMAD000136 Human FGF2 Adenovirus particle


    Target information

    Target ID GM-T31621
    Target Name FGF2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		2247
    Gene ID 100033955 (Equus caballus), 100135772 (Felis catus), 14173 (Mus musculus), 2247 (Homo sapiens)
    281161 (Bos taurus), 403857 (Canis lupus familiaris), 54250 (Rattus norvegicus), 574136 (Macaca mulatta)
    Gene Symbols & Synonyms FGF2,Fgf2,Fgfb,bFGF,Fgf-2,Fgf2a,BFGF,FGFB,FGF-2,HBGF-2
    Target Alternative Names FGF2,Fibroblast growth factor 2,FGF-2,Basic fibroblast growth factor (bFGF), Heparin-binding growth factor 2 (HBGF-2),BFGF,FGFB,FGF-2,HBGF-2
    Uniprot Accession P03969,P09038,P13109,P15655
    Additional SwissProt Accessions: P15655,P09038,P03969,P13109
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease cancer, Breast Cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Signaling pathways regulating pluripotency of stem cells, Regulation of actin cytoskeleton, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSMUSG00000037225, ENSG00000138685
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.