Human BAX/BCL2L4 ORF/cDNA clone-Adenovirus plasmid (NM_001291428.1)
Cat. No.: pGMAD000113
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human BAX/BCL2L4 adenoviral expression plasmid for BAX adenovirus packaging, BAX adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
BAX/BCL2L4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAD000113 |
| Gene Name | BAX |
| Accession Number | NM_001291428.1 |
| Gene ID | 581 |
| Species | Human |
| Product Type | Adenovirus plasmid (overexpression) |
| Insert Length | 666 bp |
| Gene Alias | BCL2L4 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | HA (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGACGGGTCCGGGGAGCAGCCCAGAGGCGGGGGGCCCACCAGCTCTGAGCAGATCATGAAGACAGGGGCCCTTTTGCTTCAGGGTTTCATCCAGGATCGAGCAGGGCGAATGGGGGGGGAGGCACCCGAGCTGGCCCTGGACCCGGTGCCTCAGGATGCGTCCACCAAGAAGCTGAGCGAGTGTCTCAAGCGCATCGGGGACGAACTGGACAGTAACATGGAGCTGCAGAGGATGATTGCCGCCGTGGACACAGACTCCCCCCGAGAGGTCTTTTTCCGAGTGGCAGCTGACATGTTTTCTGACGGCAACTTCAACTGGGGCCGGGTTGTCGCCCTTTTCTACTTTGCCAGCAAACTGGTGCTCAAGGCCCTGTGCACCAAGGTGCCGGAACTGATCAGAACCATCATGGGCTGGACATTGGACTTCCTCCGGGAGCGGCTGTTGGGCTGGATCCAAGACCAGGGTGGTTGGGGGCTGCCCCTGGCCGAGTCACTGAAGCGACTGATGTCCCTGTCTCCAGGACGGCCTCCTCTCCTACTTTGGGACGCCCACGTGGCAGACCGTGACCATCTTTGTGGCGGGAGTGCTCACCGCCTCACTCACCATCTGGAAGAAGATGGGCTGAGGCCCCCAGCTGCCTTGGACTGTGTTTTTCCTCCATAA |
| ORF Protein Sequence | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGLPLAESLKRLMSLSPGRPPLLLWDAHVADRDHLCGGSAHRLTHHLEEDGLRPPAALDCVFPP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0034-Ab | Anti-BAX monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0034-Ag | BAX protein |
| ORF Viral Vector | pGMAD000113 | Human BAX Adenovirus plasmid |
| ORF Viral Vector | pGMAP000055 | Human BAX Adenovirus plasmid |
| ORF Viral Vector | pGMLP-SPh-015 | Human BAX Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-155 | Human BAX Adenovirus plasmid |
| ORF Viral Vector | vGMAD000113 | Human BAX Adenovirus particle |
| ORF Viral Vector | vGMAP000055 | Human BAX Adenovirus particle |
| ORF Viral Vector | vGMLP-SPh-015 | Human BAX Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-155 | Human BAX Adenovirus particle |
Target information
| Target ID | GM-IP0034 |
| Target Name | BAX |
|
Gene Group Identifier (Target Gene ID in Homo species) |
581 |
| Gene ID |
100054674 (Equus caballus), 12028 (Mus musculus), 24887 (Rattus norvegicus), 280730 (Bos taurus) 403523 (Canis lupus familiaris), 493837 (Felis catus), 581 (Homo sapiens), 718948 (Macaca mulatta) |
| Gene Symbols & Synonyms | BAX,Bax,BCL2L4 |
| Target Alternative Names | Apoptosis regulator BAX,BAX,BCL2L4,Bax,Bcl-2-like protein 4 (Bcl2-L-4) |
| Uniprot Accession |
O02703,Q07812,Q07813,Q63690
Additional SwissProt Accessions: Q07813,Q63690,O02703,Q07812 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, Sphingolipid signaling pathway, p53 signaling pathway, Protein processing in endoplasmic reticulum, Apoptosis, Longevity regulating pathway, Apoptosis - multiple species, Neurotrophin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Pathogenic Escherichia coli infection, Tuberculosis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Lipid and atherosclerosis |
| Gene Ensembl | ENSECAG00000016635, ENSMUSG00000003873, ENSBTAG00000013340, ENSCAFG00845000500, ENSG00000087088, ENSMMUG00000003907 |
| Target Classification | Pathway, Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


