Human GPX1/GPXD/GSHPX1 ORF/cDNA clone-Adenovirus plasmid (NM_000581.3)

Cat. No.: pGMAD000015
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GPX1/GPXD/GSHPX1 adenoviral expression plasmid for GPX1 adenovirus packaging, GPX1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to GPX1/GPXD products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000015
Gene Name GPX1
Accession Number NM_000581.3
Gene ID 2876
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 612 bp
Gene Alias GPXD,GSHPX1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTGTGCTGCTCGGCTAGCGGCGGCGGCGGCGGCGGCCCAGTCGGTGTATGCCTTCTCGGCGCGCCCGCTGGCCGGCGGGGAGCCTGTGAGCCTGGGCTCCCTGCGGGGCAAGGTACTACTTATCGAGAATGTGGCGTCCCTCTGAGGCACCACGGTCCGGGACTACACCCAGATGAACGAGCTGCAGCGGCGCCTCGGACCCCGGGGCCTGGTGGTGCTCGGCTTCCCGTGCAACCAGTTTGGGCATCAGGAGAACGCCAAGAACGAAGAGATTCTGAATTCCCTCAAGTACGTCCGGCCTGGTGGTGGGTTCGAGCCCAACTTCATGCTCTTCGAGAAGTGCGAGGTGAACGGTGCGGGGGCGCACCCTCTCTTCGCCTTCCTGCGGGAGGCCCTGCCAGCTCCCAGCGACGACGCCACCGCGCTTATGACCGACCCCAAGCTCATCACCTGGTCTCCGGTGTGTCGCAACGATGTTGCCTGGAACTTTGAGAAGTTCCTGGTGGGCCCTGACGGTGTGCCCCTACGCAGGTACAGCCGCCGCTTCCAGACCATTGACATCGAGCCTGACATCGAAGCCCTGCTGTCTCAAGGGCCCAGCTGTGCCTAG
ORF Protein Sequence MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T70654-Ab Anti-GPX1 monoclonal antibody
    Target Antigen GM-Tg-g-T70654-Ag GPX1 protein
    ORF Viral Vector pGMAD000015 Human GPX1 Adenovirus plasmid
    ORF Viral Vector pGMAD000415 Human GPX1 Adenovirus plasmid
    ORF Viral Vector vGMAD000015 Human GPX1 Adenovirus particle
    ORF Viral Vector vGMAD000415 Human GPX1 Adenovirus particle


    Target information

    Target ID GM-T70654
    Target Name GPX1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2876
    Gene ID 100053396 (Equus caballus), 101083751 (Felis catus), 14775 (Mus musculus), 24404 (Rattus norvegicus)
    281209 (Bos taurus), 2876 (Homo sapiens), 442961 (Canis lupus familiaris), 706732 (Macaca mulatta)
    Gene Symbols & Synonyms GPX1,Gpx1,Gpx,CGPx,GPx-1,GSHPx-1,GSHPx,GPXD,GSHPX1
    Target Alternative Names CGPx,Cellular glutathione peroxidase,GPX1,GPXD,GPx-1,GSHPX1,GSHPx,GSHPx-1,Glutathione peroxidase 1,Gpx,Gpx1,Phospholipid-hydroperoxide glutathione peroxidase GPX1
    Uniprot Accession P00435,P04041,P07203,P11352
    Additional SwissProt Accessions: P11352,P04041,P00435,P07203
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Lung Cancer
    Disease from KEGG Metabolic pathways, Thyroid hormone synthesis, Arachidonic acid metabolism
    Gene Ensembl ENSMUSG00000063856, ENSBTAG00000054195, ENSG00000233276
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.