Mouse Sigmar1/Oprs1/Sig1R ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_011014.3)
Cat. No.: pGMAAV001723
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Mouse Sigmar1/Oprs1/Sig1R Adeno-associated virus expression plasmid (ITR-vector) for Sigmar1 AAV packaging, Sigmar1 AAV production.The purified Mouse Sigmar1/Oprs1/Sig1R AAV particle serves as an invaluable asset for in-depth in vivo Sigmar1 studies, mechanism of action (MOA) research, and the evolution of Sigmar1-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Product Description
| Catalog ID | pGMAAV001723 |
| Gene Name | Sigmar1 |
| Accession Number | NM_011014.3 |
| Gene ID | 18391 |
| Species | Mouse |
| Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
| Insert Length | 672 bp |
| Gene Alias | Oprs1,Sig1R,sigma1R |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | GFAP |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCGTGGGCCGCGGGACGGCGGTGGGCATGGATCACCCTGATTCTGACTATTATCGCAGTGCTGATCCAGGCCGCCTGGTTGTGGCTGGGCACTCAAAACTTCGTCTTCTCTAGAGAAGAAATAGCGCAGCTTGCTCGACAGTATGCGGGGCTGGACCATGAGCTTGCCTTCTCTCGGCTGATCGTGGAGCTGCGGAGGCTGCACCCAGGCCACGTGCTGCCGGATGAGGAGCTGCAGTGGGTATTTGTGAACGCGGGCGGCTGGATGGGCGCCATGTGTATTCTGCACGCCTCGCTGTCTGAGTACGTGCTGCTCTTCGGCACCGCCCTGGGCTCCCATGGCCATTCGGGACGATACTGGGCTGAGATTTCTGACACCATCATCTCTGGCACCTTCCACCAATGGAAAGAGGGCACCACGAAAAGTGAGGTCTTCTACCCAGGAGAGACAGTTGTACACGGGCCTGGAGAAGCAACGGCTCTGGAGTGGGGACCAAACACGTGGATGGTGGAGTACGGCCGGGGTGTTATTCCGTCTACCCTGTTCTTTGCACTAGCCGACACTTTCTTCAGCACCCAGGACTACCTCACACTCTTCTATACCCTTCGGGCCTATGCCCGGGGCCTCCGGCTTGAGCTTACCACCTACCTCTTTGGCCAAGACTCCTGA |
| ORF Protein Sequence | MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | vGMAAV001723 | Mouse Sigmar1 Adeno-associate virus(AAV) particle |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.

