Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Mouse Mdk/Mek/MK ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_010784.5)
Cat. No.: pGMAAV001350
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Mouse Mdk/Mek/MK Adeno-associated virus expression plasmid (ITR-vector) for Mdk AAV packaging, Mdk AAV production.The purified Mouse Mdk/Mek/MK AAV particle serves as an invaluable asset for in-depth in vivo Mdk studies, mechanism of action (MOA) research, and the evolution of Mdk-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Datasheet
Product Description
| Catalog ID | pGMAAV001350 |
| Gene Name | Mdk |
| Accession Number | NM_010784.5 |
| Gene ID | 17242 |
| Species | Mouse |
| Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
| Insert Length | 423 bp |
| Gene Alias | Mek,MK |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGCACCGAGGCTTCTTCCTTCTCGCCCTTCTTGCCCTCTTGGTGGTCACGTCCGCGGTGGCCAAAAAAAAAGAGAAGGTGAAGAAGGGCAGCGAGTGTTCGGAGTGGACCTGGGGGCCCTGCACCCCCAGCAGCAAGGACTGCGGCATGGGCTTCCGCGAGGGTACCTGTGGGGCCCAGACCCAGCGCGTCCATTGCAAGGTGCCCTGCAACTGGAAGAAGGAATTTGGAGCCGACTGCAAATACAAGTTTGAGAGCTGGGGGGCGTGTGATGGGAGCACTGGCACCAAAGCCCGCCAAGGGACCCTGAAGAAGGCGCGGTACAATGCCCAGTGCCAGGAGACCATCCGCGTGACTAAGCCCTGCACCTCCAAGACCAAGTCAAAGACCAAAGCCAAGAAAGGAAAAGGAAAGGACTAA |
| ORF Protein Sequence | MQHRGFFLLALLALLVVTSAVAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | vGMAAV001350 | Mouse Mdk Adeno-associate virus(AAV) particle |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.