Human CCL14/CC-1/CC-3 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_032963.4)

Cat. No.: pGMAAV001201
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL14/CC-1/CC-3 Adeno-associated virus expression plasmid (ITR-vector) for CCL14 AAV packaging, CCL14 AAV production.The purified Human CCL14/CC-1/CC-3 AAV particle serves as an invaluable asset for in-depth in vivo CCL14 studies, mechanism of action (MOA) research, and the evolution of CCL14-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL14/CC-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV001201
Gene Name CCL14
Accession Number NM_032963.4
Gene ID 6358
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 282 bp
Gene Alias CC-1,CC-3,CKB1,HCC-1,HCC-1(1-74),HCC-1/HCC-3,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGATCTCCGTGGCTGCCATTCCCTTCTTCCTCCTCATCACCATCGCCCTAGGGACCAAGACTGAATCCTCCTCACGGGGACCTTACCACCCCTCAGAGTGCTGCTTCACCTACACTACCTACAAGATCCCGCGTCAGCGGATTATGGATTACTATGAGACCAACAGCCAGTGCTCCAAGCCCGGAATTGTCTTCATCACCAAAAGGGGCCATTCCGTCTGTACCAACCCCAGTGACAAGTGGGTCCAGGACTATATCAAGGACATGAAGGAGAACTGA
ORF Protein Sequence MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0740-Ab Anti-CCL14/ CC-1/ CC-3 functional antibody
    Target Antigen GM-Tg-g-SE0740-Ag CCL14 protein
    Cytokine cks-Tg-g-GM-SE0740 chemokine (C-C motif) ligand 14 (CCL14) protein & antibody
    ORF Viral Vector pGMLV001557 Human CCL14 Lentivirus plasmid
    ORF Viral Vector pGMAAV001201 Human CCL14 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000173 Human CCL14 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001557 Human CCL14 Lentivirus particle
    ORF Viral Vector vGMAAV001201 Human CCL14 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0740
    Target Name CCL14
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6358
    Gene ID 6358 (Homo sapiens), 716765 (Macaca mulatta)
    Gene Symbols & Synonyms CCL14,CC-1,CC-3,CKB1,MCIF,NCC2,SY14,HCC-1,HCC-3,NCC-2,SCYL2,SCYA14,HCC-1(1-74),HCC-1/HCC-3
    Target Alternative Names C-C motif chemokine 14,CC-1,CC-3,CCL14,CKB1,Chemokine CC-1/CC-3 (HCC-1/HCC-3),HCC-1,HCC-1(1-74),HCC-1/HCC-3,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14,Small-inducible cytokine A14
    Uniprot Accession Q16627
    Additional SwissProt Accessions: Q16627
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway
    Gene Ensembl ENSG00000276409, ENSMMUG00000002466
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.