Human VEGFA/MVCD1/VEGF ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_001171626.1)
Cat. No.: pGMAAV000786
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human VEGFA/MVCD1/VEGF Adeno-associated virus expression plasmid (ITR-vector) for VEGFA AAV packaging, VEGFA AAV production.The purified Human VEGFA/MVCD1/VEGF AAV particle serves as an invaluable asset for in-depth in vivo VEGFA studies, mechanism of action (MOA) research, and the evolution of VEGFA-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
VEGFA/MVCD1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAAV000786 |
| Gene Name | VEGFA |
| Accession Number | NM_001171626.1 |
| Gene ID | 7422 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
| Insert Length | 576 bp |
| Gene Alias | MVCD1,VEGF,VPF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAACTTTCTGCTGTCTTGGGTGCATTGGAGCCTTGCCTTGCTGCTCTACCTCCACCATGCCAAGTGGTCCCAGGCTGCACCCATGGCAGAAGGAGGAGGGCAGAATCATCACGAAGTGGTGAAGTTCATGGATGTCTATCAGCGCAGCTACTGCCATCCAATCGAGACCCTGGTGGACATCTTCCAGGAGTACCCTGATGAGATCGAGTACATCTTCAAGCCATCCTGTGTGCCCCTGATGCGATGCGGGGGCTGCTGCAATGACGAGGGCCTGGAGTGTGTGCCCACTGAGGAGTCCAACATCACCATGCAGATTATGCGGATCAAACCTCACCAAGGCCAGCACATAGGAGAGATGAGCTTCCTACAGCACAACAAATGTGAATGCAGACCAAAGAAAGATAGAGCAAGACAAGAAAATCCCTGTGGGCCTTGCTCAGAGCGGAGAAAGCATTTGTTTGTACAAGATCCGCAGACGTGTAAATGTTCCTGCAAAAACACAGACTCGCGTTGCAAGGCGAGGCAGCTTGAGTTAAACGAACGTACTTGCAGATGTGACAAGCCGAGGCGGTGA |
| ORF Protein Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T20761 |
| Target Name | VEGFA |
|
Gene Group Identifier (Target Gene ID in Homo species) |
7422 |
| Gene ID |
100033839 (Equus caballus), 22339 (Mus musculus), 281572 (Bos taurus), 403802 (Canis lupus familiaris) 493845 (Felis catus), 574209 (Macaca mulatta), 7422 (Homo sapiens), 83785 (Rattus norvegicus) |
| Gene Symbols & Synonyms | VEGFA,Vegfa,VPF,Vpf,Vegf,L-VEGF,VEGF,VEGF-A,eVEGF120,eVEGF164,MVCD1,VEGF111,VEGF164 |
| Target Alternative Names | L-VEGF,MVCD1,VEGF,VEGF-A,VEGF111,VEGF164,VEGFA,VPF,Vascular endothelial growth factor A,Vascular permeability factor (VPF),Vegf,Vegfa,Vpf,eVEGF120,eVEGF164,long form |
| Uniprot Accession |
P15691,P15692,P16612,Q00731,Q9GKR0,Q9MYV3
Additional SwissProt Accessions: Q9GKR0,Q00731,P15691,Q9MYV3,P15692,P16612 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer, Lung Cancer, Malignant neoplasm of prostate, Chronic Kidney Disease, Malignant neoplasm of bladder, Type 2 diabetes mellitus with diabetic nephropathy, Urinary bladder urothelial carcinoma |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, HIF-1 signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Human cytomegalovirus infection, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Renal cell carcinoma, Pancreatic cancer, Bladder cancer, Rheumatoid arthritis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000009402, ENSMUSG00000023951, ENSMMUG00000004577, ENSG00000112715 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


