Human PI3/cementoin/ESI ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_002638.4)
Cat. No.: pGMAAV000494
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PI3/cementoin/ESI Adeno-associated virus expression plasmid (ITR-vector) for PI3 AAV packaging, PI3 AAV production.The purified Human PI3/cementoin/ESI AAV particle serves as an invaluable asset for in-depth in vivo PI3 studies, mechanism of action (MOA) research, and the evolution of PI3-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
Elafin/Skalp/PI3/PI3/cementoin products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV000494 |
Gene Name | PI3 |
Accession Number | NM_002638.4 |
Gene ID | 5266 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 354 bp |
Gene Alias | cementoin,ESI,SKALP,WAP3,WFDC14 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGGGCCAGCAGCTTCTTGATCGTGGTGGTGTTCCTCATCGCTGGGACGCTGGTTCTAGAGGCAGCTGTCACGGGAGTTCCTGTTAAAGGTCAAGACACTGTCAAAGGCCGTGTTCCATTCAATGGACAAGATCCCGTTAAAGGACAAGTTTCAGTTAAAGGTCAAGATAAAGTCAAAGCGCAAGAGCCAGTCAAAGGTCCAGTCTCCACTAAGCCTGGCTCCTGCCCCATTATCTTGATCCGGTGCGCCATGTTGAATCCCCCTAACCGCTGCTTGAAAGATACTGACTGCCCAGGAATCAAGAAGTGCTGTGAAGGCTCTTGCGGGATGGCCTGTTTCGTTCCCCAGTGA |
ORF Protein Sequence | MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0406-Ab | Anti-ELAF/ PI3/ ESI functional antibody |
Target Antigen | GM-Tg-g-SE0406-Ag | PI3 protein |
ORF Viral Vector | pGMLP004215 | Human PI3 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000494 | Human PI3 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMLP004215 | Human PI3 Lentivirus particle |
ORF Viral Vector | vGMAAV000494 | Human PI3 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-SE0406 |
Target Name | Elafin/Skalp/PI3 |
Gene Group Identifier (Target Gene ID in Homo species) |
5266 |
Gene ID |
100056125 (Equus caballus), 101090932 (Felis catus), 477241 (Canis lupus familiaris), 5266 (Homo sapiens) 574237 (Macaca mulatta) |
Gene Symbols & Synonyms | PI3,SKALP,trappin-2,ESI,WAP3,WFDC14,cementoin,TRAPPIN-2 |
Target Alternative Names | Elafin, Skalp, PI3,Elafin,Elastase-specific inhibitor (ESI), Peptidase inhibitor 3 (PI-3), Protease inhibitor WAP3, Skin-derived antileukoproteinase (SKALP), WAP four-disulfide core domain protein 14,ESI,WAP3,SKALP,WFDC14,cementoin |
Uniprot Accession |
P19957
Additional SwissProt Accessions: P19957 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | |
Disease | Ovary Cancer |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000014295, ENSCAFG00845014356, ENSG00000124102, ENSMMUG00000063099 |
Target Classification | Pathway |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.