Human SERPINF1/EPC-1/OI12 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_002615.7)

Cat. No.: pGMAAV000386
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SERPINF1/EPC-1/OI12 Adeno-associated virus expression plasmid (ITR-vector) for SERPINF1 AAV packaging, SERPINF1 AAV production.The purified Human SERPINF1/EPC-1/OI12 AAV particle serves as an invaluable asset for in-depth in vivo SERPINF1 studies, mechanism of action (MOA) research, and the evolution of SERPINF1-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Serpin F1/PEDF/SERPINF1/SERPINF1/EPC-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000386
Gene Name SERPINF1
Accession Number NM_002615.7
Gene ID 5176
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 1257 bp
Gene Alias EPC-1,OI12,OI6,PEDF,PIG35
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCCCTGGTGCTACTCCTCTGCATTGGAGCCCTCCTCGGGCACAGCAGCTGCCAGAACCCTGCCAGCCCCCCGGAGGAGGGCTCCCCAGACCCCGACAGCACAGGGGCGCTGGTGGAGGAGGAGGATCCTTTCTTCAAAGTCCCCGTGAACAAGCTGGCAGCGGCTGTCTCCAACTTCGGCTATGACCTGTACCGGGTGCGATCCAGCACGAGCCCCACGACCAACGTGCTCCTGTCTCCTCTCAGTGTGGCCACGGCCCTCTCGGCCCTCTCGCTGGGAGCGGAGCAGCGAACAGAATCCATCATTCACCGGGCTCTCTACTATGACTTGATCAGCAGCCCAGACATCCATGGTACCTATAAGGAGCTCCTTGACACGGTCACTGCCCCCCAGAAGAACCTCAAGAGTGCCTCCCGGATCGTCTTTGAGAAGAAGCTGCGCATAAAATCCAGCTTTGTGGCACCTCTGGAAAAGTCATATGGGACCAGGCCCAGAGTCCTGACGGGCAACCCTCGCTTGGACCTGCAAGAGATCAACAACTGGGTGCAGGCGCAGATGAAAGGGAAGCTCGCCAGGTCCACAAAGGAAATTCCCGATGAGATCAGCATTCTCCTTCTCGGTGTGGCGCACTTCAAGGGGCAGTGGGTAACAAAGTTTGACTCCAGAAAGACTTCCCTCGAGGATTTCTACTTGGATGAAGAGAGGACCGTGAGGGTCCCCATGATGTCGGACCCTAAGGCTGTTTTACGCTATGGCTTGGATTCAGATCTCAGCTGCAAGATTGCCCAGCTGCCCTTGACCGGAAGCATGAGTATCATCTTCTTCCTGCCCCTGAAAGTGACCCAGAATTTGACCTTGATAGAGGAGAGCCTCACCTCCGAGTTCATTCATGACATAGACCGAGAACTGAAGACCGTGCAGGCGGTCCTCACTGTCCCCAAGCTGAAGCTGAGTTATGAAGGCGAAGTCACCAAGTCCCTGCAGGAGATGAAGCTGCAATCCTTGTTTGATTCACCAGACTTTAGCAAGATCACAGGCAAACCCATCAAGCTGACTCAGGTGGAACACCGGGCTGGCTTTGAGTGGAACGAGGATGGGGCGGGAACCACCCCCAGCCCAGGGCTGCAGCCTGCCCACCTCACCTTCCCGCTGGACTATCACCTTAACCAGCCTTTCATCTTCGTACTGAGGGACACAGACACAGGGGCCCTTCTCTTCATTGGCAAGATTCTGGACCCCAGGGGCCCCTAA
ORF Protein Sequence MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T54447-Ab Anti-PEDF/ SERPINF1/ EPC-1 functional antibody
    Target Antigen GM-Tg-g-T54447-Ag SERPINF1 protein
    ORF Viral Vector pGMLP002696 Human SERPINF1 Lentivirus plasmid
    ORF Viral Vector pGMLV001287 Human SERPINF1 Lentivirus plasmid
    ORF Viral Vector pGMLV001341 Human Serpinf1 Lentivirus plasmid
    ORF Viral Vector pGMAAV000386 Human SERPINF1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000744 Human SERPINF1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001020 Human SERPINF1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001028 Human SERPINF1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002696 Human SERPINF1 Lentivirus particle
    ORF Viral Vector vGMLV001287 Human SERPINF1 Lentivirus particle
    ORF Viral Vector vGMLV001341 Human Serpinf1 Lentivirus particle
    ORF Viral Vector vGMAAV000386 Human SERPINF1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T54447
    Target Name Serpin F1/PEDF/SERPINF1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5176
    Gene ID 100072415 (Equus caballus), 101099915 (Felis catus), 20317 (Mus musculus), 281386 (Bos taurus)
    287526 (Rattus norvegicus), 5176 (Homo sapiens), 611276 (Canis lupus familiaris), 721262 (Macaca mulatta)
    Gene Symbols & Synonyms SERPINF1,Serpinf1,PEDF,Pedf,Sdf3,EPC-1,Pedfl,Dmrs91,OI6,OI12,PIG35
    Target Alternative Names Cell proliferation-inducing gene 35 protein,Dmrs91,EPC-1,OI12,OI6,PEDF,PIG35,Pedf,Pedfl,Pigment epithelium-derived factor,SERPINF1,Sdf3,Serpin F1,Serpinf1
    Uniprot Accession P36955,P97298,Q95121
    Additional SwissProt Accessions: P97298,Q95121,P36955
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Complications of kidney transplant, Dent disease, Diabetic Nephropathy, Perinatal necrotizing enterocolitis
    Disease from KEGG Wnt signaling pathway
    Gene Ensembl ENSECAG00000022279, ENSMUSG00000000753, ENSBTAG00000009705, ENSG00000132386, ENSCAFG00845013723, ENSMMUG00000022194
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.