Human TNFSF15/TL1/TL1A ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_005118)

Cat. No.: pGMAAV000281
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TNFSF15/TL1/TL1A Adeno-associated virus expression plasmid (ITR-vector) for TNFSF15 AAV packaging, TNFSF15 AAV production.The purified Human TNFSF15/TL1/TL1A AAV particle serves as an invaluable asset for in-depth in vivo TNFSF15 studies, mechanism of action (MOA) research, and the evolution of TNFSF15-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.


Target products collection

Go to TNFSF15/TL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000281
Gene Name TNFSF15
Accession Number NM_005118
Gene ID 9966
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 756 bp
Gene Alias TL1,TL1A,TNLG1B,VEGI,VEGI192A
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter TBG
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCGAGGATCTGGGACTGAGCTTTGGGGAAACAGCCAGTGTGGAAATGCTGCCAGAGCACGGCAGCTGCAGGCCCAAGGCCAGGAGCAGCAGCGCACGCTGGGCTCTCACCTGCTGCCTGGTGTTGCTCCCCTTCCTTGCAGGACTCACCACATACCTGCTTGTCAGCCAGCTCCGGGCCCAGGGAGAGGCCTGTGTGCAGTTCCAGGCTCTAAAAGGACAGGAGTTTGCACCTTCACATCAGCAAGTTTATGCACCTCTTAGAGCAGACGGAGATAAGCCAAGGGCACACCTGACAGTTGTGAGACAAACTCCCACACAGCACTTTAAAAATCAGTTCCCAGCTCTGCACTGGGAACATGAACTAGGCCTGGCCTTCACCAAGAACCGAATGAACTATACCAACAAATTCCTGCTGATCCCAGAGTCGGGAGACTACTTCATTTACTCCCAGGTCACATTCCGTGGGATGACCTCTGAGTGCAGTGAAATCAGACAAGCAGGCCGACCAAACAAGCCAGACTCCATCACTGTGGTCATCACCAAGGTAACAGACAGCTACCCTGAGCCAACCCAGCTCCTCATGGGGACCAAGTCTGTATGCGAAGTAGGTAGCAACTGGTTCCAGCCCATCTACCTCGGAGCCATGTTCTCCTTGCAAGAAGGGGACAAGCTAATGGTGAACGTCAGTGACATCTCTTTGGTGGATTACACAAAAGAAGATAAAACCTTCTTTGGAGCCTTCTTACTATAG
ORF Protein Sequence MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T35212-Ab Anti-TNF15/ TNFSF15/ TL1 monoclonal antibody
    Target Antigen GM-Tg-g-T35212-Ag TNFSF15 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T35212 Tumor necrosis factor superfamily member 15 (TNFSF15) protein & antibody
    ORF Viral Vector pGMLP004530 Human TNFSF15 Lentivirus plasmid
    ORF Viral Vector pGMAAV000281 Human TNFSF15 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP004530 Human TNFSF15 Lentivirus particle
    ORF Viral Vector vGMAAV000281 Human TNFSF15 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T35212
    Target Name TNFSF15
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9966
    Gene ID 100049906 (Equus caballus), 101099505 (Felis catus), 252878 (Rattus norvegicus), 326623 (Mus musculus)
    481688 (Canis lupus familiaris), 514239 (Bos taurus), 703189 (Macaca mulatta), 9966 (Homo sapiens)
    Gene Symbols & Synonyms TNFSF15,Tnfsf15,TNLG1B,Tnlg1b,Tl1,Tl1a,Vegi,TL1,TL1A,VEGI,VEGI192A
    Target Alternative Names TL1,TL1A,TNF ligand-related molecule 1,TNFSF15,TNLG1B,Tl1,Tl1a,Tnfsf15,Tnlg1b,Tumor necrosis factor ligand superfamily member 15,VEGI,VEGI192A,Vascular endothelial cell growth inhibitor,Vegi
    Uniprot Accession O95150,Q5UBV8,Q8K3Y7
    Additional SwissProt Accessions: Q8K3Y7,Q5UBV8,O95150
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000014513, ENSMUSG00000050395, ENSBTAG00000018069, ENSMMUG00000012892, ENSG00000181634
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.