Human FGF19 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_005117.2)

Cat. No.: pGMAAV000215
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF19/ Adeno-associated virus expression plasmid (ITR-vector) for FGF19 AAV packaging, FGF19 AAV production.The purified Human FGF19/ AAV particle serves as an invaluable asset for in-depth in vivo FGF19 studies, mechanism of action (MOA) research, and the evolution of FGF19-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF19 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000215
Gene Name FGF19
Accession Number NM_005117.2
Gene ID 9965
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 651 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGAGCGGGTGTGTGGTGGTCCACGTATGGATCCTGGCCGGCCTCTGGCTGGCCGTGGCCGGGCGCCCCCTCGCCTTCTCGGACGCGGGGCCCCACGTGCACTACGGCTGGGGCGACCCCATCCGCCTGCGGCACCTGTACACCTCCGGCCCCCACGGGCTCTCCAGCTGCTTCCTGCGCATCCGTGCCGACGGCGTCGTGGACTGCGCGCGGGGCCAGAGCGCGCACAGTTTGCTGGAGATCAAGGCAGTCGCTCTGCGGACCGTGGCCATCAAGGGCGTGCACAGCGTGCGGTACCTCTGCATGGGCGCCGACGGCAAGATGCAGGGGCTGCTTCAGTACTCGGAGGAAGACTGTGCTTTCGAGGAGGAGATCCGCCCAGATGGCTACAATGTGTACCGATCCGAGAAGCACCGCCTCCCGGTCTCCCTGAGCAGTGCCAAACAGCGGCAGCTGTACAAGAACAGAGGCTTTCTTCCACTCTCTCATTTCCTGCCCATGCTGCCCATGGTCCCAGAGGAGCCTGAGGACCTCAGGGGCCACTTGGAATCTGACATGTTCTCTTCGCCCCTGGAGACCGACAGCATGGACCCATTTGGGCTTGTCACCGGACTGGAGGCCGTGAGGAGTCCCAGCTTTGAGAAGTAA
ORF Protein Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0215-Ab Anti-FGF19 functional antibody
    Target Antigen GM-Tg-g-SE0215-Ag FGF19 protein
    Cytokine cks-Tg-g-GM-SE0215 fibroblast growth factor 19 (FGF19) protein & antibody
    ORF Viral Vector pGMLP004563 Human FGF19 Lentivirus plasmid
    ORF Viral Vector pGMAAV000215 Human FGF19 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP004563 Human FGF19 Lentivirus particle
    ORF Viral Vector vGMAAV000215 Human FGF19 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0215
    Target Name FGF19
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9965
    Gene ID 100060488 (Equus caballus), 101087099 (Felis catus), 14170 (Mus musculus), 170582 (Rattus norvegicus)
    483681 (Canis lupus familiaris), 521475 (Bos taurus), 709109 (Macaca mulatta), 9965 (Homo sapiens)
    Gene Symbols & Synonyms FGF19,Fgf15,Fgf19,Fgf8a,FGF8A
    Target Alternative Names FGF-19,FGF19,FGF8A,Fgf15,Fgf19,Fgf8a,Fibroblast growth factor 19
    Uniprot Accession O35622,O95750
    Additional SwissProt Accessions: O35622,O95750
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000036646, ENSMUSG00000031073, ENSCAFG00845015136, ENSBTAG00000017285, ENSMMUG00000053386, ENSG00000162344
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.