Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
Plasmid quantity:
- 10mg, 50mg, 100mg, 500mg, >1g
Talk to our Expert:
- • Research Grade
- • Endotoxin-Free Grade
- • High Quality (HQ) Grade
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human SERPINA1/A1A/A1AT ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_000295.4)
Cat. No.: pGMAAV000168
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SERPINA1/A1A/A1AT Adeno-associated virus expression plasmid (ITR-vector) for SERPINA1 AAV packaging, SERPINA1 AAV production.The purified Human SERPINA1/A1A/A1AT AAV particle serves as an invaluable asset for in-depth in vivo SERPINA1 studies, mechanism of action (MOA) research, and the evolution of SERPINA1-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Datasheet
Go to
Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1/SERPINA1/A1A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAAV000168 |
| Gene Name | SERPINA1 |
| Accession Number | NM_000295.4 |
| Gene ID | 5265 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
| Insert Length | 1257 bp |
| Gene Alias | A1A,A1AT,AAT,alpha1AT,nNIF,PI,PI1,PRO2275 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTGCCTGGTCCCTGTCTCCCTGGCTGAGGATCCCCAGGGAGATGCTGCCCAGAAGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATCACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACACCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAGCCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAATCCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGCTCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGCCTGAAGCTAGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTTCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATTACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTTGACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCAAATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACGTGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATGTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTGCTGCTGATGAAATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAACTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTGGAAAATGAAGACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCATTACTGGAACCTATGATCTGAAGAGCGTCCTGGGTCAACTGGGCATCACTAAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCCCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGAAAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCTATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGAACAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCAAAAATAA |
| ORF Protein Sequence | MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T28265-Ab | Anti-A1AT/ SERPINA1/ A1A functional antibody |
| Target Antigen | GM-Tg-g-T28265-Ag | SERPINA1 protein |
| ORF Viral Vector | pGMLP003894 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001493 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001572 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002164 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000168 | Human SERPINA1 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000441 | Human SERPINA1 Adenovirus plasmid |
| ORF Viral Vector | vGMLP003894 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMLV001493 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMLV001572 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMLV002164 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMAAV000168 | Human SERPINA1 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000441 | Human SERPINA1 Adenovirus particle |
Target information
| Target ID | GM-T28265 |
| Target Name | Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
5265 |
| Gene ID |
24648 (Rattus norvegicus), 280699 (Bos taurus), 480422 (Canis lupus familiaris), 5265 (Homo sapiens) 701361 (Macaca mulatta) |
| Gene Symbols & Synonyms | Serpina1,SERPINA1,Pi,AAT,Spi1,PI,A1A,PI1,A1AT,nNIF,PRO2275,alpha1AT |
| Target Alternative Names | A1A,A1AT,AAT,Alpha 1 Antitrypsin,Alpha-1 protease inhibitor,Alpha-1-antiproteinase,Alpha-1-antitrypsin,PI,PI1,PRO2275,Pi,SERPINA1,Serpin A1,Serpina1,Spi1,alpha1AT,nNIF |
| Uniprot Accession |
P01009,P17475,P34955
Additional SwissProt Accessions: P17475,P34955,P01009 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer, Malignant neoplasm of bladder, IgA glomerulonephritis, Nephrotic syndrome with focal and segmental glomerular lesions, Diabetic Nephropathy, Contrast - Induced Nephropathy, Congenital occlusion of ureteropelvic junction, Calculus of kidney, Nephrotic syndrome, Acute pancreatitis, Juvenile arthritis, Urinary bladder urothelial carcinoma, Type 2 diabetes mellitus with diabetic nephropathy, protease |
| Disease from KEGG | Complement and coagulation cascades |
| Gene Ensembl | ENSBTAG00000018843, ENSCAFG00845002999, ENSG00000197249, ENSMMUG00000020426 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.