Human CXCL12/IRH/PBSF ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_000609)

Cat. No.: pGMAAV000139
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CXCL12/IRH/PBSF Adeno-associated virus expression plasmid (ITR-vector) for CXCL12 AAV packaging, CXCL12 AAV production.The purified Human CXCL12/IRH/PBSF AAV particle serves as an invaluable asset for in-depth in vivo CXCL12 studies, mechanism of action (MOA) research, and the evolution of CXCL12-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CXCL12/SDF-1/CXCL12/IRH products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000139
Gene Name CXCL12
Accession Number NM_000609
Gene ID 6387
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 282 bp
Gene Alias IRH,PBSF,SCYB12,SDF1,TLSF,TPAR1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACGCCAAGGTCGTGGTCGTGCTGGTCCTCGTGCTGACCGCGCTCTGCCTCAGCGACGGGAAGCCCGTCAGCCTGAGCTACAGATGCCCATGCCGATTCTTCGAAAGCCATGTTGCCAGAGCCAACGTCAAGCATCTCAAAATTCTCAACACTCCAAACTGTGCCCTTCAGATTGTAGCCCGGCTGAAGAACAACAACAGACAAGTGTGCATTGACCCGAAGCTAAAGTGGATTCAGGAGTACCTGGAGAAAGCTTTAAACAAGAGGTTCAAGATGTGA
ORF Protein Sequence MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T04773-Ab Anti-SDF1/ CXCL12/ IRH functional antibody
    Target Antigen GM-Tg-g-T04773-Ag CXCL12 protein
    Cytokine cks-Tg-g-GM-T04773 chemokine (C-X-C motif) ligand 12 (CXCL12) protein & antibody
    ORF Viral Vector pGMLV000007 Human CXCL12 Lentivirus plasmid
    ORF Viral Vector pGMLV000955 Human CXCL12 Lentivirus plasmid
    ORF Viral Vector pGMLV002285 Human CXCL12 Lentivirus plasmid
    ORF Viral Vector pGMAD000581 Human CXCL12 Adenovirus plasmid
    ORF Viral Vector pGMAAV000139 Human CXCL12 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000581 Human CXCL12 Adenovirus plasmid
    ORF Viral Vector pGMPC001800 Human CXCL12 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000007 Human CXCL12 Lentivirus particle
    ORF Viral Vector vGMLV000955 Human CXCL12 Lentivirus particle
    ORF Viral Vector vGMLV002285 Human CXCL12 Lentivirus particle
    ORF Viral Vector vGMAD000581 Human CXCL12 Adenovirus particle
    ORF Viral Vector vGMAAV000139 Human CXCL12 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000581 Human CXCL12 Adenovirus particle


    Target information

    Target ID GM-T04773
    Target Name CXCL12/SDF-1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6387
    Gene ID 100049872 (Equus caballus), 20315 (Mus musculus), 24772 (Rattus norvegicus), 449622 (Canis lupus familiaris)
    493806 (Felis catus), 574334 (Macaca mulatta), 613811 (Bos taurus), 6387 (Homo sapiens)
    Gene Symbols & Synonyms CXCL12,Cxcl12,SDF1,Pbsf,Sdf1,Tlsf,Tpar1,Scyb12,SDF-1,IRH,PBSF,TLSF,TPAR1,SCYB12
    Target Alternative Names C-X-C motif chemokine 12,CXCL12,Cxcl12,IRH,Intercrine reduced in hepatomas (IRH,PBSF,Pbsf,Pre-B cell growth-stimulating factor (PBSF),SCYB12,SDF-1,SDF1,Scyb12,Sdf1,Stromal cell-derived factor 1,TLSF,TPAR1,Tlsf,Tpar1,hIRH),hSDF-1
    Uniprot Accession O62657,P40224,P48061
    Additional SwissProt Accessions: P40224,O62657,P48061
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, NF-kappa B signaling pathway, Axon guidance, Leukocyte transendothelial migration, Intestinal immune network for IgA production, Regulation of actin cytoskeleton, Human cytomegalovirus infection, Pathways in cancer, Rheumatoid arthritis
    Gene Ensembl ENSECAG00000019551, ENSMUSG00000061353, ENSCAFG00845026834, ENSMMUG00000012181, ENSBTAG00000005077, ENSG00000107562
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.