Rat Cxcl12/Sdf1 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_022177.3)
Cat. No.: pGMAAV000080
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Rat Cxcl12/Sdf1 Adeno-associated virus expression plasmid (ITR-vector) for Cxcl12 AAV packaging, Cxcl12 AAV production.The purified Rat Cxcl12/Sdf1 AAV particle serves as an invaluable asset for in-depth in vivo Cxcl12 studies, mechanism of action (MOA) research, and the evolution of Cxcl12-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Product Description
| Catalog ID | pGMAAV000080 |
| Gene Name | Cxcl12 |
| Accession Number | NM_022177.3 |
| Gene ID | 24772 |
| Species | Rat |
| Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
| Insert Length | 270 bp |
| Gene Alias | Sdf1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGACGCCAAGGTCGTCGCCGTGCTGGCCCTGGTGCTGGCCGCGCTCTGCATCAGTGACGGTAAGCCAGTCAGCCTGAGCTACAGATGCCCCTGCCGATTCTTTGAGAGCCATGTCGCCAGAGCCAACGTCAAACATCTGAAAATCCTCAACACTCCAAACTGTGCCCTTCAGATTGTTGCAAGGCTGAAAAGCAACAACAGACAAGTGTGCATTGACCCGAAATTAAAGTGGATCCAAGAGTACCTGGACAAAGCCTTAAACAAGTAA |
| ORF Protein Sequence | MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | vGMAAV000080 | Rat Cxcl12 Adeno-associate virus(AAV) particle |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.

