Human NPPB/BNP ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_002521.2)

Cat. No.: pGMAAV000027
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NPPB/BNP Adeno-associated virus expression plasmid (ITR-vector) for NPPB AAV packaging, NPPB AAV production.The purified Human NPPB/BNP AAV particle serves as an invaluable asset for in-depth in vivo NPPB studies, mechanism of action (MOA) research, and the evolution of NPPB-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to BNP/NPPB/NPPB/BNP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000027
Gene Name NPPB
Accession Number NM_002521.2
Gene ID 4879
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 405 bp
Gene Alias BNP
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATCCCCAGACAGCACCTTCCCGGGCGCTCCTGCTCCTGCTCTTCTTGCATCTGGCTTTCCTGGGAGGTCGTTCCCACCCGCTGGGCAGCCCCGGTTCAGCCTCGGACTTGGAAACGTCCGGGTTACAGGAGCAGCGCAACCATTTGCAGGGCAAACTGTCGGAGCTGCAGGTGGAGCAGACATCCCTGGAGCCCCTCCAGGAGAGCCCCCGTCCCACAGGTGTCTGGAAGTCCCGGGAGGTAGCCACCGAGGGCATCCGTGGGCACCGCAAAATGGTCCTCTACACCCTGCGGGCACCACGAAGCCCCAAGATGGTGCAAGGGTCTGGCTGCTTTGGGAGGAAGATGGACCGGATCAGCTCCTCCAGTGGCCTGGGCTGCAAAGTGCTGAGGCGGCATTAA
ORF Protein Sequence MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T55302-Ab Anti-ANFB/ BNP/ NPPB functional antibody
    Target Antigen GM-Tg-g-T55302-Ag BNP/NPPB protein
    ORF Viral Vector pGMAAV000027 Human NPPB Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMAAV000027 Human NPPB Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T55302
    Target Name BNP/NPPB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4879
    Gene ID 100056123 (Equus caballus), 18158 (Mus musculus), 25105 (Rattus norvegicus), 487441 (Canis lupus familiaris)
    4879 (Homo sapiens), 493764 (Felis catus), 508734 (Bos taurus), 715053 (Macaca mulatta)
    Gene Symbols & Synonyms NPPB,Nppb,BNF,BNP,Iso-ANP,Bnf,NNX
    Target Alternative Names BNF,BNP,Bnf,Brain natriuretic factor prohormone (preproBNP,Gamma-brain natriuretic peptide,Iso-ANP,NNX,NPPB,Natriuretic peptides B,Nppb,proBNP)
    Uniprot Accession P13204,P13205,P16859,P16860,P40753
    Additional SwissProt Accessions: P40753,P13205,P16859,P16860,P13204
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker
    Disease
    Disease from KEGG cGMP-PKG signaling pathway, Vascular smooth muscle contraction
    Gene Ensembl ENSECAG00000014282, ENSMUSG00000029019, ENSCAFG00845001994, ENSG00000120937, ENSBTAG00000021739, ENSMMUG00000055655
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.