Human RSPO1/CRISTIN3/RSPO ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_001038633.3)
Cat. No.: pGMAAV000008
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RSPO1/CRISTIN3/RSPO Adeno-associated virus expression plasmid (ITR-vector) for RSPO1 AAV packaging, RSPO1 AAV production.The purified Human RSPO1/CRISTIN3/RSPO AAV particle serves as an invaluable asset for in-depth in vivo RSPO1 studies, mechanism of action (MOA) research, and the evolution of RSPO1-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
RSPO1/CRISTIN3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMAAV000008 |
| Gene Name | RSPO1 |
| Accession Number | NM_001038633.3 |
| Gene ID | 284654 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
| Insert Length | 792 bp |
| Gene Alias | CRISTIN3,RSPO |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCGGCTTGGGCTGTGTGTGGTGGCCCTGGTTCTGAGCTGGACGCACCTCACCATCAGCAGCCGGGGGATCAAGGGGAAAAGGCAGAGGCGGATCAGTGCCGAGGGGAGCCAGGCCTGTGCCAAAGGCTGTGAGCTCTGCTCTGAAGTCAACGGCTGCCTCAAGTGCTCACCCAAGCTGTTCATCCTGCTGGAGAGGAACGACATCCGCCAGGTGGGCGTCTGCTTGCCGTCCTGCCCACCTGGATACTTCGACGCCCGCAACCCCGACATGAACAAGTGCATCAAATGCAAGATCGAGCACTGTGAGGCCTGCTTCAGCCATAACTTCTGCACCAAGTGTAAGGAGGGCTTGTACCTGCACAAGGGCCGCTGCTATCCAGCTTGTCCCGAGGGCTCCTCAGCTGCCAATGGCACCATGGAGTGCAGTAGTCCTGCGCAATGTGAAATGAGCGAGTGGTCTCCGTGGGGGCCCTGCTCCAAGAAGCAGCAGCTCTGTGGTTTCCGGAGGGGCTCCGAGGAGCGGACACGCAGGGTGCTACATGCCCCTGTGGGGGACCATGCTGCCTGCTCTGACACCAAGGAGACCCGGAGGTGCACAGTGAGGAGAGTGCCGTGTCCTGAGGGGCAGAAGAGGAGGAAGGGAGGCCAGGGCCGGCGGGAGAATGCCAACAGGAACCTGGCCAGGAAGGAGAGCAAGGAGGCGGGTGCTGGCTCTCGAAGACGCAAGGGGCAGCAACAGCAGCAGCAGCAAGGGACAGTGGGGCCACTCACATCTGCAGGGCCTGCCTAG |
| ORF Protein Sequence | MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T91023-Ab | Anti-RSPO1/ CRISTIN3/ RSPO functional antibody |
| Target Antigen | GM-Tg-g-T91023-Ag | RSPO1 protein |
| ORF Viral Vector | pGMLP003166 | Human RSPO1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002698 | Human RSPO1 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000008 | Human RSPO1 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLP003166 | Human RSPO1 Lentivirus particle |
| ORF Viral Vector | vGMLV002698 | Human RSPO1 Lentivirus particle |
| ORF Viral Vector | vGMAAV000008 | Human RSPO1 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T91023 |
| Target Name | RSPO1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
284654 |
| Gene ID |
100054745 (Equus caballus), 101091033 (Felis catus), 192199 (Mus musculus), 284654 (Homo sapiens) 313589 (Rattus norvegicus), 511675 (Bos taurus), 608179 (Canis lupus familiaris), 713976 (Macaca mulatta) |
| Gene Symbols & Synonyms | RSPO1,Rspo1,Rspondin,R-spondin,RSPO,CRISTIN3,RGD1565558 |
| Target Alternative Names | CRISTIN3,R-spondin,R-spondin-1,RGD1565558,RSPO,RSPO1,Roof plate-specific spondin-1 (hRspo1),Rspo1,Rspondin |
| Uniprot Accession |
Q2MKA7,Q9Z132
Additional SwissProt Accessions: Q9Z132,Q2MKA7 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | Wnt signaling pathway |
| Gene Ensembl | ENSECAG00000022683, ENSMUSG00000028871, ENSG00000169218, ENSCAFG00845030653, ENSMMUG00000008420 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


